BYKdb

Annotate results for A0A175Y2U6

A0A175Y2U6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A175Y2U6
DOMAINtad29/203RVPLVRQYLRIALRWRYVILGAVVGCVLLGLVATILMTPKYTATVTVEILRESSKVTDFQ
GVEREASLADQEFYQTQYGLLRSRTLAERVANQLRLVDDPKFFKLFGVAKDTKAFRLVNG
RYPAAGRAERQRIAGEVLLRNTGVNPTRMSRLVDVSFTSPDPAFTARVANAWAES
DOMAINcd546/735TSTRPAEGKSTTALALATTLARAQRRVILVDGDMRSPSVHHLGGVDHDRGLSNFLAGDDA
IETLVFEMRDLNFTAMSAGPIPPNAAELLTGNRLSILIERLLEHYDHVVVDSPPVMGLAD
APLIASRVEGVVYAVESHGIRSSMVKTALGRLVSANVRIIGGVLTKFEARKAHYGYGYEY
GYGYGRNEGT
SITEWalker A553/555GKS
SITEWalker A'573/580ILVDGDMR
SITEWalker B653/659VVVDSPP
SITEY Cluster719/729YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNMIPSSIRGNAPAGGFAPPEPRLFETDRVPLVRQYLRIALRWRYVILGAVVGCVLLGLVATILMTPKYTATVTVEILRE
                            RVPLVRQYLRIALRWRYVILGAVVGCVLLGLVATILMTPKYTATVTVEILRE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSKVTDFQGVEREASLADQEFYQTQYGLLRSRTLAERVANQLRLVDDPKFFKLFGVAKDTKAFRLVNGRYPAAGRAERQR
SSKVTDFQGVEREASLADQEFYQTQYGLLRSRTLAERVANQLRLVDDPKFFKLFGVAKDTKAFRLVNGRYPAAGRAERQR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAGEVLLRNTGVNPTRMSRLVDVSFTSPDPAFTARVANAWAESFIQTNLERKVQATSYGSNLLQRQLALQKQRLDDSQRQ
IAGEVLLRNTGVNPTRMSRLVDVSFTSPDPAFTARVANAWAES                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVNYASAQQIINLPAQSGNGTTTGTAERSIVADDLAALNAALSQATAERIQAEARSRQAGQGGASTEALRNQAINSLRQR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAELAADYQRLMVQFEPEYPAAKAIKSQIDQLDRSIAREESRVTGSQLADYREAQERERVLQAKVDQLKSSYLDLRRRSI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYNIYQQEVDTNRALYDGLLQRFKEIGIAGGVGVNNVSIVDQADVPQKPSSPRLLLNLAFSLLAGLGLGALLAFGLEQMD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAVTDPGDVERRLGLPLLGSVPKLESGTPKDALLDRKSDLVDAYLAVQANLGFSTEHGVPRSMAITSTRPAEGKSTTALA
                                                                 TSTRPAEGKSTTALA
                                                                        GKS     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LATTLARAQRRVILVDGDMRSPSVHHLGGVDHDRGLSNFLAGDDAIETLVFEMRDLNFTAMSAGPIPPNAAELLTGNRLS
LATTLARAQRRVILVDGDMRSPSVHHLGGVDHDRGLSNFLAGDDAIETLVFEMRDLNFTAMSAGPIPPNAAELLTGNRLS
            ILVDGDMR                                                            
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILIERLLEHYDHVVVDSPPVMGLADAPLIASRVEGVVYAVESHGIRSSMVKTALGRLVSANVRIIGGVLTKFEARKAHYG
ILIERLLEHYDHVVVDSPPVMGLADAPLIASRVEGVVYAVESHGIRSSMVKTALGRLVSANVRIIGGVLTKFEARKAHYG
            VVVDSPP                                                           YG
       730       
....:....|....:..
YGYEYGYGYGRNEGTKV
YGYEYGYGYGRNEGT  
YGYEYGYGY        

© 1998-2019