BYKdb

Annotate results for A0A176EEV5

A0A176EEV5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176EEV5
DOMAINtad1/132MLGILLTFLTTPLYQASARLEVSQITADVTNLDTLESDSKVSELQYLNTQYELLVSRFMA
KRVMEAGNLSRDAEFRETFGLVDGPNLDAQIERALFDNVSVHPLFQSSLVDVKFSSPSPT
ISAKIANLWVQE
DOMAINcd458/650TSSVPSEGKSISSVGVATSFAQLGKRTLLIDADLRNSKLPITLDLQDYDKGGLVPLLASQ
ETNMASQVIHLEKFGFDFLPMGRTPPNPVELLAGERFAQIIEEARASYDQVLIDGAPMLA
LADAIEIAKSADGVVFVMEAERIKLRGIENALGRLRRSGAHIYGGIVTKVSEKNSAYGYG
YGYGYGYGYGYGE
SITEWalker A465/467GKS
SITEWalker A'485/492LLIDADLR
SITEWalker B568/574VLIDGAP
SITEY Cluster634/648YGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLGILLTFLTTPLYQASARLEVSQITADVTNLDTLESDSKVSELQYLNTQYELLVSRFMAKRVMEAGNLSRDAEFRETFG
MLGILLTFLTTPLYQASARLEVSQITADVTNLDTLESDSKVSELQYLNTQYELLVSRFMAKRVMEAGNLSRDAEFRETFG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDGPNLDAQIERALFDNVSVHPLFQSSLVDVKFSSPSPTISAKIANLWVQEFVAANYEKRFGANIEARDFLQSQIGELR
LVDGPNLDAQIERALFDNVSVHPLFQSSLVDVKFSSPSPTISAKIANLWVQE                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERLAESEQQLVEYANANEILVLNAGGDSGSESAGQTLVGADLEALNTALAAAVADRISAQAAVIGGNFPGDDPRNVLLAS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSKSEAELAVLRSTFGSDYPQVQEKLAEVQSLRSAISSGSRDLLQSARLREAELRDQVEKVKQRFLGQQGQGIRYGILKR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVDTNREIYDALLQRFKELEASGAGQNNIQIIDEADAPTGPYAPSLFLNLFGAFVASLVFVVGVVYFKVALSQTLQDPDD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRRRLGIALLGAIPREKQGTIIESLIERSAEINEAYTTVRTNMNFLTPKGAPDVLMFTSSVPSEGKSISSVGVATSFAQL
                                                         TSSVPSEGKSISSVGVATSFAQL
                                                                GKS             
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKRTLLIDADLRNSKLPITLDLQDYDKGGLVPLLASQETNMASQVIHLEKFGFDFLPMGRTPPNPVELLAGERFAQIIEE
GKRTLLIDADLRNSKLPITLDLQDYDKGGLVPLLASQETNMASQVIHLEKFGFDFLPMGRTPPNPVELLAGERFAQIIEE
    LLIDADLR                                                                    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARASYDQVLIDGAPMLALADAIEIAKSADGVVFVMEAERIKLRGIENALGRLRRSGAHIYGGIVTKVSEKNSAYGYGYGY
ARASYDQVLIDGAPMLALADAIEIAKSADGVVFVMEAERIKLRGIENALGRLRRSGAHIYGGIVTKVSEKNSAYGYGYGY
       VLIDGAP                                                           YGYGYGY
       650     
....:....|....:
GYGYGYGYGEQAAKT
GYGYGYGYGE     
GYGYGYGY       
© 1998-2019