BYKdb

Annotate results for A0A176HIG2

A0A176HIG2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176HIG2
DOMAINtad31/189VAIDLERYWHEAIGLKYWLAGLITLGVLIGILITLLATPLYQASARLEVSQVTADVTNLD
SLEVDSQISELQYLNTQYELLVSRFMAKRVMDAGNLSRDEAFREAFGIEEEEPQARSIQR
LLFENVSISPISQSSLVDVTFSSPDPAVSAEITNLWVRE
DOMAINcd515/707TSSVPSEGKSISSLGVATSFAQLGKRVLLIDADLRNSKLRETLDLFDYDKGGLVPLLANQ
QTDMASQIIHLEDLGFDFLPMGRTPPNPVELLAGDRFSQIIEAARGQYDQVLIDGAPMLA
LADAIEMSKAVDGVIFVIQTERIKLRGIENALGRLQRSGAKVYGAIVTKVSQNNSAYGYG
YGYGYGYGYGYGE
SITEWalker A522/524GKS
SITEWalker A'542/549LLIDADLR
SITEWalker B625/631VLIDGAP
SITEY Cluster691/705YGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNLNFPSHDVAERDDRREPIDDRGSSNDSVAIDLERYWHEAIGLKYWLAGLITLGVLIGILITLLATPLYQASARLEVS
                              VAIDLERYWHEAIGLKYWLAGLITLGVLIGILITLLATPLYQASARLEVS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVTADVTNLDSLEVDSQISELQYLNTQYELLVSRFMAKRVMDAGNLSRDEAFREAFGIEEEEPQARSIQRLLFENVSISP
QVTADVTNLDSLEVDSQISELQYLNTQYELLVSRFMAKRVMDAGNLSRDEAFREAFGIEEEEPQARSIQRLLFENVSISP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISQSSLVDVTFSSPDPAVSAEITNLWVREFVAANYEKRFGANIEARDFLQSQIAELRERLSDSERELVEYANANEILVLN
ISQSSLVDVTFSSPDPAVSAEITNLWVRE                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGGETGSESAGQTLVGADLQALNMALAAAVADRVSAQAAVVGGNFPSGDPRNQLLTNLSEAEAELAVLRANFGPEYPEVQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKQAEVNSLRSAISGGARGLLDSARIREAELRDQVEQVKQRFLSQQGQGISYGILKREVDTNREIYDALLQRFKELEASG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGQNNIQIIDEADVPAEPYAPSLIQNVLISLIVSLMLAGGLVYLKVALSQTLKDPEDVRRRLHLALLGAIPRNTEGKMVD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIIERSSHINEAYTTVRTNMNFLTPQGAPEVLMFTSSVPSEGKSISSLGVATSFAQLGKRVLLIDADLRNSKLRETLDLF
                                  TSSVPSEGKSISSLGVATSFAQLGKRVLLIDADLRNSKLRETLDLF
                                         GKS                 LLIDADLR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYDKGGLVPLLANQQTDMASQIIHLEDLGFDFLPMGRTPPNPVELLAGDRFSQIIEAARGQYDQVLIDGAPMLALADAIE
DYDKGGLVPLLANQQTDMASQIIHLEDLGFDFLPMGRTPPNPVELLAGDRFSQIIEAARGQYDQVLIDGAPMLALADAIE
                                                                VLIDGAP         
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
MSKAVDGVIFVIQTERIKLRGIENALGRLQRSGAKVYGAIVTKVSQNNSAYGYGYGYGYGYGYGYGEERDAEPA
MSKAVDGVIFVIQTERIKLRGIENALGRLQRSGAKVYGAIVTKVSQNNSAYGYGYGYGYGYGYGYGE       
                                                  YGYGYGYGYGYGYGY         

© 1998-2019