BYKdb

Annotate results for A0A176HMS5

A0A176HMS5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176HMS5
DOMAINtad17/191EVIDLSHYWQVIRRQLKKIILFSAIITVIAVLVALAITPVYRATATILIEAEEAKVLSIE
EVYGLGSASDEYYQTQFEILKSRELAKRTVLELGLIDNPEFNPAHPANKKSFSIKEMILG
EAEPLTEEEILAETVDTFWEAVSISPVRKTQLVKVSVESESAEMARAAANAMAQQ
DOMAINcd539/730TSSVPSEGKTTTSTNIAEAFGQMEKTLLIDCDMRRPSVAKKLGLAPNVPGLSNAVAYPDM
LDECIQSRPELGIDVVSAGPIPPNPLELLGSKNFRDILDTLRGRYQRIIIDSAPMQAVSD
ALYLSTLVDGVVYVVKADATKDKLAQDGLSKLDNNNARVLGVVLNQVNIDREAKYADSYA
GYYDVYGYSSKS
SITEWalker A546/548GKT
SITEWalker A'565/572LLIDCDMR
SITEWalker B646/652IIIDSAP
SITEY Cluster713/726YADSYAGYYDVYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDNNMKSAGMNSHAAVEVIDLSHYWQVIRRQLKKIILFSAIITVIAVLVALAITPVYRATATILIEAEEAKVLSIEEVYG
                EVIDLSHYWQVIRRQLKKIILFSAIITVIAVLVALAITPVYRATATILIEAEEAKVLSIEEVYG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGSASDEYYQTQFEILKSRELAKRTVLELGLIDNPEFNPAHPANKKSFSIKEMILGEAEPLTEEEILAETVDTFWEAVSI
LGSASDEYYQTQFEILKSRELAKRTVLELGLIDNPEFNPAHPANKKSFSIKEMILGEAEPLTEEEILAETVDTFWEAVSI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPVRKTQLVKVSVESESAEMARAAANAMAQQFIESQLDAKVEVTQQAAGWLSDRLGGLKAKLEASERKLQQYREDNDLVD
SPVRKTQLVKVSVESESAEMARAAANAMAQQ                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEGVDTLVAKEIDQITEALVEARARRLELQGTYEQLQSLGALNYDNLSSLPSIISNPVVVNLRDAETQAELKVSELKKRY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPLHPKMIAAESDLEAVRESVLTQMKRIATSIESNYLVAQSKENSLEKALRNSKSDVRNLNRTEFTLSEYQREVRTNRQL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YEAFFNRVSETSATGDLQTANARVVDPAIKPVVPVKPNKKLIVLLALVVSGMFGVALAFLLDILDSTIKNLDDVERKLDV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PMLGLLPLVGKKQDAGDAEQMVRAFVGEGMDGFRESVRTLRTGLTLASMEHPASVILVTSSVPSEGKTTTSTNIAEAFGQ
                                                          TSSVPSEGKTTTSTNIAEAFGQ
                                                                 GKT            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKTLLIDCDMRRPSVAKKLGLAPNVPGLSNAVAYPDMLDECIQSRPELGIDVVSAGPIPPNPLELLGSKNFRDILDTLR
MEKTLLIDCDMRRPSVAKKLGLAPNVPGLSNAVAYPDMLDECIQSRPELGIDVVSAGPIPPNPLELLGSKNFRDILDTLR
    LLIDCDMR                                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRYQRIIIDSAPMQAVSDALYLSTLVDGVVYVVKADATKDKLAQDGLSKLDNNNARVLGVVLNQVNIDREAKYADSYAGY
GRYQRIIIDSAPMQAVSDALYLSTLVDGVVYVVKADATKDKLAQDGLSKLDNNNARVLGVVLNQVNIDREAKYADSYAGY
     IIIDSAP                                                            YADSYAGY
       730   
....:....|...
YDVYGYSSKSVQG
YDVYGYSSKS   
YDVYGY       

© 1998-2019