BYKdb

Annotate results for A0A176JBT8

A0A176JBT8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176JBT8
DOMAINtad3/142KTFEIKDLLNILRKNKILITSIPFVCLLIGFIYTYFIASPIYESKTDLLVNTTPTANTAE
PVSPLEIDASLKLIETYQYILKSQRMADLVIKDLDGLLTEDEFLDNVKAESNGNSQIISI
IVENKNPDDAALIANKTAVI
DOMAINcd276/457TSTSAGDGKSLTCGNLAVTLAKDNKKVVFVDSDMRKPNGHSLFNLHNRCGLTNYLTGFSS
SDEIIQSTAIPKLSFISAGPISPNPHELIISKKMDLLIDRLKQKFDVILFDSSPLLVSDS
ILLSGKMDGCIYVLNARKTNRDDANEKIELLKRSSNELIGAILNEKKTHKSNPHYYYGGY
MG
SITEWalker A283/285GKS
SITEWalker A'303/310VFVDSDMR
SITEWalker B383/389ILFDSSP
SITEY Cluster450/455YYYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKTFEIKDLLNILRKNKILITSIPFVCLLIGFIYTYFIASPIYESKTDLLVNTTPTANTAEPVSPLEIDASLKLIETYQ
  KTFEIKDLLNILRKNKILITSIPFVCLLIGFIYTYFIASPIYESKTDLLVNTTPTANTAEPVSPLEIDASLKLIETYQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YILKSQRMADLVIKDLDGLLTEDEFLDNVKAESNGNSQIISIIVENKNPDDAALIANKTAVIFQSEIKKLMKIENVNILT
YILKSQRMADLVIKDLDGLLTEDEFLDNVKAESNGNSQIISIIVENKNPDDAALIANKTAVI                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IATPYSSTSKPILLFNLLLSFAAGLILATIFVLIKELKNKKFESKKGITDLLGIPYLGEIPAIIPQGPTNKYLDERYNKL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAHTEPHSSSSEAYRSVRANLDILRQSKQPVTILVTSTSAGDGKSLTCGNLAVTLAKDNKKVVFVDSDMRKPNGHSLFNL
                                   TSTSAGDGKSLTCGNLAVTLAKDNKKVVFVDSDMRKPNGHSLFNL
                                          GKS                 VFVDSDMR          
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HNRCGLTNYLTGFSSSDEIIQSTAIPKLSFISAGPISPNPHELIISKKMDLLIDRLKQKFDVILFDSSPLLVSDSILLSG
HNRCGLTNYLTGFSSSDEIIQSTAIPKLSFISAGPISPNPHELIISKKMDLLIDRLKQKFDVILFDSSPLLVSDSILLSG
                                                              ILFDSSP           
       410       420       430       440       450       
....:....|....:....|....:....|....:....|....:....|....:..
KMDGCIYVLNARKTNRDDANEKIELLKRSSNELIGAILNEKKTHKSNPHYYYGGYMG
KMDGCIYVLNARKTNRDDANEKIELLKRSSNELIGAILNEKKTHKSNPHYYYGGYMG
                                                 YYYGGY  
© 1998-2019