BYKdb

Annotate results for A0A176S762

A0A176S762 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A176S762
DOMAINcd36/233TSSIPNEGKTTFAINQAFALGQMAKTLLIDADMRRPSIAKSLGLNDDAPGLSDLVTGERG
LDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYEYIVIDSAPTIA
VSDALVLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYG
YGYGYGKNYYGYYKSYYG
SITEWalker A43/45GKT
SITEWalker A'62/69LLIDADMR
SITEWalker B146/152IVIDSAP
SITE-143/-171YEYIVIDSAPTIAVSDALVLAKYASGVLY
SITEY Cluster213/232YYGYGYGYGKNYYGYYKSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFLKEPKSAFAESVRTARTGIMLSNLDIKHKVLIVTSSIPNEGKTTFAINQAFALGQMAKTLLIDADMRRPSIAKSLGLN
                                   TSSIPNEGKTTFAINQAFALGQMAKTLLIDADMRRPSIAKSLGLN
                                          GKT                LLIDADMR           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDAPGLSDLVTGERGLDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYEYIVIDSAPTIAVSDAL
DDAPGLSDLVTGERGLDECIDDHLSKDGRNVDIIPSGVVPPNPLDLLSSSRFGELLEQLSQDYEYIVIDSAPTIAVSDAL
                                                                 IVIDSAP        
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
VLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYGYGYGYGKNYYGYYKSYYGEK
VLAKYASGVLYVIKANATPYQLVREGLKRLRQVKAPVHHIVLNQLDIHKPSKYYGYGYGYGKNYYGYYKSYYG  
                                                    YYGYGYGYGKNYYGYYKSYY   
© 1998-2019