BYKdb

Annotate results for A0A176U8D6

A0A176U8D6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176U8D6
DOMAINtad19/153VTIDFFGIFHAIAKRWYIVLLAAVACGVALGVYGRFVVKDAYESEASMCIIDSNKEVSMS
DLQVGSALTNDYEGIIKSRVVLTKAIANLKLDIEYKDLYNAVSIENPDGTRIIKINVVSQ
DQKEAVDIANEILQI
DOMAINcd277/471TSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVLQRRMGLDGVKLGLSEYLSGNA
ELGQVIYDVGLPNMHVLFSGKLVPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVG
DAAIVASFCDGALLVIENGVTKKKTLAQMKSEMDKVGANVIGVVQNMVGSKKDSSYYGKG
NYGYYYGNYGNNQNK
SITEWalker A284/286GKS
SITEWalker A'304/311LLVDTDMR
SITEWalker B385/391VIFDTPP
SITE-382/-384YDY
SITEY Cluster452/465YYGKGNYGYYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVFMNSDEVMIVNEDEDEVTIDFFGIFHAIAKRWYIVLLAAVACGVALGVYGRFVVKDAYESEASMCIIDSNKEVSMSDL
                  VTIDFFGIFHAIAKRWYIVLLAAVACGVALGVYGRFVVKDAYESEASMCIIDSNKEVSMSDL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVGSALTNDYEGIIKSRVVLTKAIANLKLDIEYKDLYNAVSIENPDGTRIIKINVVSQDQKEAVDIANEILQISIEEIPN
QVGSALTNDYEGIIKSRVVLTKAIANLKLDIEYKDLYNAVSIENPDGTRIIKINVVSQDQKEAVDIANEILQI       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGSSVPTVLDKAELSFTENTRHSILFYSVIGVVVGLFLACGIIALMVITNVSVKTDEDVQKCTGLSVLGAIPDYKGKKQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKIMWPENLPFNASEAIYQLRTGILYSSKDVKTIAVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVLQRRMG
                                    TSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVLQRRMG
                                           GKS                 LLVDTDMR         
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDGVKLGLSEYLSGNAELGQVIYDVGLPNMHVLFSGKLVPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAI
LDGVKLGLSEYLSGNAELGQVIYDVGLPNMHVLFSGKLVPNASALLSAKWLENLCAEVRDSYDYVIFDTPPICVVGDAAI
                                                                VIFDTPP         
       410       420       430       440       450       460       470  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VASFCDGALLVIENGVTKKKTLAQMKSEMDKVGANVIGVVQNMVGSKKDSSYYGKGNYGYYYGNYGNNQNKK
VASFCDGALLVIENGVTKKKTLAQMKSEMDKVGANVIGVVQNMVGSKKDSSYYGKGNYGYYYGNYGNNQNK 
                                                   YYGKGNYGYYYGNY       
© 1998-2019