BYKdb

Annotate results for A0A176UCN8

A0A176UCN8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176UCN8
DOMAINtad1/135MGLRDYARVARTYWKHIAVVTLIVTLLATAWSTFRPRIYAAEASAVVLAVGTDNVSSLLA
GDTLAKARAKNYKSLAESRLVADNVRLSTGLNMSSDALLGAISVTVPRDTAEIRITAESP
DPTIAQRVADAWIVE
DOMAINcd285/473TSSVSGEGKSTIAANLASAMSAGGEQVIVVDGDLRHPSMAKIFDVIPGIGITDVLTGKAE
VDDVLQQRSDLPNLSILGSGRIPPNPTELLGSHAMKQLIESLSEKGIVIIDAPPLLPVTD
AVLLARIADGAIVVVRAGRTTKDQLTKSLGNIRKVHGAVLGTLLNCVPAKEFDGYSYYSS
DPDSADNDP
SITEWalker A292/294GKS
SITEWalker A'312/319IVVDGDLR
SITEWalker B392/398VIIDAPP
SITEY Cluster459/462YSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLRDYARVARTYWKHIAVVTLIVTLLATAWSTFRPRIYAAEASAVVLAVGTDNVSSLLAGDTLAKARAKNYKSLAESRL
MGLRDYARVARTYWKHIAVVTLIVTLLATAWSTFRPRIYAAEASAVVLAVGTDNVSSLLAGDTLAKARAKNYKSLAESRL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VADNVRLSTGLNMSSDALLGAISVTVPRDTAEIRITAESPDPTIAQRVADAWIVELSKQVQDRERAATATSGQPLEAVTP
VADNVRLSTGLNMSSDALLGAISVTVPRDTAEIRITAESPDPTIAQRVADAWIVE                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLSLVPLDPAALPTTPVSPGVALTAVYGAALGLLLAYASALLRDRLDRRLHTAAEVEHLFSVPVIGALPVDLRLTGENKV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGGVPAAPTPGSRAQSPAFAEALRELRTNLTFLDVDNPPRIIVVTSSVSGEGKSTIAANLASAMSAGGEQVIVVDGDLRH
                                            TSSVSGEGKSTIAANLASAMSAGGEQVIVVDGDLRH
                                                   GKS                 IVVDGDLR 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSMAKIFDVIPGIGITDVLTGKAEVDDVLQQRSDLPNLSILGSGRIPPNPTELLGSHAMKQLIESLSEKGIVIIDAPPLL
PSMAKIFDVIPGIGITDVLTGKAEVDDVLQQRSDLPNLSILGSGRIPPNPTELLGSHAMKQLIESLSEKGIVIIDAPPLL
                                                                       VIIDAPP  
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVTDAVLLARIADGAIVVVRAGRTTKDQLTKSLGNIRKVHGAVLGTLLNCVPAKEFDGYSYYSSDPDSADNDPSEDADDS
PVTDAVLLARIADGAIVVVRAGRTTKDQLTKSLGNIRKVHGAVLGTLLNCVPAKEFDGYSYYSSDPDSADNDP       
                                                          YSYY                  
       490       500       
....:....|....:....|....:..
PVVIEPESPPAFRGSSREQTSRSVTSF


© 1998-2019