BYKdb

Annotate results for A0A176YCF4

A0A176YCF4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A176YCF4
DOMAINtad21/187MSTVIDQLTGLVRRQYRVFVIVPTAALALGLLYLLVTPSQYTATATLLIDSSTLRVLQNQ
LQPQGDVPLDTLQVGSQVEILASRKLGLAVVKDLHLADDPEFTGAGGWSLFPRLGSDTPD
EREQRALDEFLARRTITRAEKTYALNISYTSRSAATAARVANAIAEA
DOMAINcd582/772TSTLPSEGKSTVASNLAALMADAGRRVVLIDADLRNPTLARSLTPRPQTGWLEVLSGKLD
LAQATGRESTTGLALLPLLLTEAPVHSDEILASQGFRDLLDRLRQTYDYIIVDLPPLAPV
VDVRAIVPVIDSFVFVVGWGNTSVKTARRHLMAEPELHDRLLGVVLNKANLRMLERFEQP
GVYQNGYYMRG
SITEWalker A589/591GKS
SITEWalker A'609/616VLIDADLR
SITEWalker B691/697IIVDLPP
SITE-688/-690YDY
SITEY Cluster764/774YQNGYYMRGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLPRRMQVDYGAGREQASSSMSTVIDQLTGLVRRQYRVFVIVPTAALALGLLYLLVTPSQYTATATLLIDSSTLRVLQNQ
                    MSTVIDQLTGLVRRQYRVFVIVPTAALALGLLYLLVTPSQYTATATLLIDSSTLRVLQNQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQPQGDVPLDTLQVGSQVEILASRKLGLAVVKDLHLADDPEFTGAGGWSLFPRLGSDTPDEREQRALDEFLARRTITRAE
LQPQGDVPLDTLQVGSQVEILASRKLGLAVVKDLHLADDPEFTGAGGWSLFPRLGSDTPDEREQRALDEFLARRTITRAE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTYALNISYTSRSAATAARVANAIAEAYIDDQLGAKYQTVTRAGAWLQDRINELKSKATAADRAVLEFKEKNNIVDVGGG
KTYALNISYTSRSAATAARVANAIAEA                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SASAGAGTSSRLIGEQQLVELNSQLAAARGATSDAKARLDRIEQVRKLDVSEGAVADTLKNDVITRLRNQYLDLSAREAN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISGRYGSDHAAAANLRDQMEEVRRNIGAELGRIAGSYKSDYEIARTREENLERSLAALVSEGQLTNRDRLGLAELESSAK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYHTLFDNFLQRYMEAIQQQSFPITDARIISPAVAPTKKSKPVTSLVLAIALSLGLIASVGIAALREAIDGVFRTARQAE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELRARCLSVIPLASASASPVPALARSSAAVSGDQADPAGLPSPQSVAQHATPDAQHYTFTDSLKRRAVDDPISVFTEAF


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAIKVAAWLQASVRDTKVIGITSTLPSEGKSTVASNLAALMADAGRRVVLIDADLRNPTLARSLTPRPQTGWLEVLSGKL
                     TSTLPSEGKSTVASNLAALMADAGRRVVLIDADLRNPTLARSLTPRPQTGWLEVLSGKL
                            GKS                 VLIDADLR                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLAQATGRESTTGLALLPLLLTEAPVHSDEILASQGFRDLLDRLRQTYDYIIVDLPPLAPVVDVRAIVPVIDSFVFVVGW
DLAQATGRESTTGLALLPLLLTEAPVHSDEILASQGFRDLLDRLRQTYDYIIVDLPPLAPVVDVRAIVPVIDSFVFVVGW
                                                  IIVDLPP                       
       730       740       750       760       770       
....:....|....:....|....:....|....:....|....:....|....:..
GNTSVKTARRHLMAEPELHDRLLGVVLNKANLRMLERFEQPGVYQNGYYMRGGYSIP
GNTSVKTARRHLMAEPELHDRLLGVVLNKANLRMLERFEQPGVYQNGYYMRG     
                                           YQNGYYMRGGY   

© 1998-2019