BYKdb

Annotate results for A0A177KZU6

A0A177KZU6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A177KZU6
DOMAINcd56/236TSTSPGEGKSTTIANLAVVFANQGKKVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTT
LDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLENSLEKYDFVLFDTPPVLAVTD
AQVLANQCDGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGK
E
SITE-193/-195GKT
SITEWalker A'83/90LLVDADMR
SITEWalker B163/169VLFDTPP
SITEY Cluster229/233YYYYY
SITEWalker A63/65GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALKGKKKTPAAPGSAKRKLITYTDPKSPISEQYRTIRTNILFSSVDQSLRSILVTSTSPGEGKSTTIANLAVVFANQGK
                                                       TSTSPGEGKSTTIANLAVVFANQGK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLENSLEKY
KVLLVDADMRKPTMHYTFGLQNTFGLTNILTKQTTLDATAVQSDIENLSILTSGPIPPNPAELLGSVSMKEFLENSLEKY
  LLVDADMR                                                                      
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
DFVLFDTPPVLAVTDAQVLANQCDGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGKE
DFVLFDTPPVLAVTDAQVLANQCDGTILVVNSGKTEIEGVQKAKDLLQSVKAKLLGVVLNNRTMKDSSYYYYYGKE
  VLFDTPP                                                           YYYYY   
© 1998-2019