BYKdb

Annotate results for A0A177NPZ0

A0A177NPZ0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A177NPZ0
DOMAINtad22/284QSVSIRDYVDLLVEGRKTILVAVAAVLTLALAYLVLAPRTYKADALLRIDKNKALLVANL
RGDNNQTPAEAESPRAQREVEILRSRSVLGKVVDNLNLAIEIQPYYFPLIGETLARRHDR
HDGVAGAWWGFGRWAWGGERVKVAAFEVPDRYLEKEFTLIALEHGRYRLLAPNGDELLAG
EVGQVATAEVGEKTPVTIKVEALAAHPGTHFELVRRTALSAIETLQKAFAVKEVSKDTDI
LSVELKGRDPEQLAKSVNDIAAI
DOMAINcd560/746SSPAPGMGKSFVSSNLAALLASIKKRVLVIDADMRNGRLHDTFGIGKQPGLSDLLAGRAT
LGEVIVSLPEIGIDLIPRGNMVLNPAELLVLGELSETLRQLQSFYNHIVIDSPPILGATD
AAILGKHADATFLVVKEGRYTAQELEVSARRFQQVGINPNGFIINDMKQGSSYYPYYGYA
YQRADQE
SITEWalker A567/569GKS
SITEWalker A'587/594LVIDADMR
SITEWalker B667/673IVIDSPP
SITEY Cluster732/740YYPYYGYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVPHNEATPVLALPNPSRLQEQSVSIRDYVDLLVEGRKTILVAVAAVLTLALAYLVLAPRTYKADALLRIDKNKALLVAN
                     QSVSIRDYVDLLVEGRKTILVAVAAVLTLALAYLVLAPRTYKADALLRIDKNKALLVAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRGDNNQTPAEAESPRAQREVEILRSRSVLGKVVDNLNLAIEIQPYYFPLIGETLARRHDRHDGVAGAWWGFGRWAWGGE
LRGDNNQTPAEAESPRAQREVEILRSRSVLGKVVDNLNLAIEIQPYYFPLIGETLARRHDRHDGVAGAWWGFGRWAWGGE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVKVAAFEVPDRYLEKEFTLIALEHGRYRLLAPNGDELLAGEVGQVATAEVGEKTPVTIKVEALAAHPGTHFELVRRTAL
RVKVAAFEVPDRYLEKEFTLIALEHGRYRLLAPNGDELLAGEVGQVATAEVGEKTPVTIKVEALAAHPGTHFELVRRTAL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIETLQKAFAVKEVSKDTDILSVELKGRDPEQLAKSVNDIAAIYVNATVNWESAEASQKLAFLESQLPVVKERLEKAEQ
SAIETLQKAFAVKEVSKDTDILSVELKGRDPEQLAKSVNDIAAI                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLSAYRQQHGAVDISAEAEILLKQASDMETLSIQLKQKYDEQSQRLESEHPDMIATNAQIKRVNNKLAALEKRIKDLPKT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQNMVSLSRDVQVNTELYTSLLNSAQEQRIAAAGSLGNSRIVDFAVVPEKPYWPKPGLLLAIATLLGLSLGSALIFLRHS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQRHDNYPALLEYQVGLPMFAAIPHSKKQRKLGRLLGRDKDGGILASQDPLDISVESLRGLRTTLEATLASRESKVIMVS
                                                                               S

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPAPGMGKSFVSSNLAALLASIKKRVLVIDADMRNGRLHDTFGIGKQPGLSDLLAGRATLGEVIVSLPEIGIDLIPRGNM
SPAPGMGKSFVSSNLAALLASIKKRVLVIDADMRNGRLHDTFGIGKQPGLSDLLAGRATLGEVIVSLPEIGIDLIPRGNM
      GKS                 LVIDADMR                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLNPAELLVLGELSETLRQLQSFYNHIVIDSPPILGATDAAILGKHADATFLVVKEGRYTAQELEVSARRFQQVGINPNG
VLNPAELLVLGELSETLRQLQSFYNHIVIDSPPILGATDAAILGKHADATFLVVKEGRYTAQELEVSARRFQQVGINPNG
                          IVIDSPP                                               
       730       740       750       760       770       780   
....:....|....:....|....:....|....:....|....:....|....:....|...
FIINDMKQGSSYYPYYGYAYQRADQEPVAAGGWSDKYHAVGDWLSKQLERDWQPAAAETDERG
FIINDMKQGSSYYPYYGYAYQRADQE                                     
           YYPYYGYAY                                           

© 1998-2019