BYKdb

Annotate results for A0A177P2D2

A0A177P2D2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A177P2D2
DOMAINtad20/201DAIDLRQLQDFFWRRWKVVVATAIVVMAVAFLALLMVTPRFTATAQILLEPRKEKIFGAE
QILPELNLETSNVDSQVSVIQSINLLRRVVEKEKLTQDKEFGASQKLGLFGFLTGLFSSS
EPAGKVEPQGGDQIPPEVLASIQRLRNALEVQRVNRTFVLSISVNSEDPAKAVRLTNAVA
DA
DOMAINcd552/739TSSFPSEGKSTLAQSLAWSAVKAGMRVMLIDGDLRHPSISKQFGAEAKPGLVDFLTSAVP
LEQAVIRLDDLTVLPAGSKSQNPPDLLGSERMRQLSEKLRDLFDYIVVDSPPVGPVIDAK
VLASLADKVVFSVRWRMTPRETVAEHIQYFMQHHKLAGAALSLVDESQAPRYGAYSQYYG
KYYKKYYQ
SITEWalker A559/561GKS
SITEWalker A'579/586MLIDGDLR
SITEWalker B657/663IVVDSPP
SITEY Cluster723/738YGAYSQYYGKYYKKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHGQISKALTQVNSDGGESDAIDLRQLQDFFWRRWKVVVATAIVVMAVAFLALLMVTPRFTATAQILLEPRKEKIFGAEQ
                   DAIDLRQLQDFFWRRWKVVVATAIVVMAVAFLALLMVTPRFTATAQILLEPRKEKIFGAEQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILPELNLETSNVDSQVSVIQSINLLRRVVEKEKLTQDKEFGASQKLGLFGFLTGLFSSSEPAGKVEPQGGDQIPPEVLAS
ILPELNLETSNVDSQVSVIQSINLLRRVVEKEKLTQDKEFGASQKLGLFGFLTGLFSSSEPAGKVEPQGGDQIPPEVLAS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQRLRNALEVQRVNRTFVLSISVNSEDPAKAVRLTNAVADAFVVDRLDARYDAAKRASSWLTERMESLRDTLRQSEEAVA
IQRLRNALEVQRVNRTFVLSISVNSEDPAKAVRLTNAVADA                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DFRKEHNLVTTNADAKVTVSEQQLSELNGKLITARAETAEKRAKYEQVAQVMQKGGNLQAIPDVVRSTVIADLRKQQAEV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARKEADLSTRYDVQHPMLINTRAERRDIERSIAAEVQRILTNLKNDYDVAKSREESLDASLKQVTGETGIDGGVGVRLRE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LERINAANKTLFENFLSRAKITQEQSTFEENEARVISPAIRPGAPSFPKKGLVLSLAGVVGLLIGIGGAVALDMLNSGFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSREIEEKLGTPVLASLPLLSAKDREVDGKTLEPARYVIAKPLSRYAESIRNIRVGIQMADVDNPAKVILVTSSFPSEGK
                                                                       TSSFPSEGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STLAQSLAWSAVKAGMRVMLIDGDLRHPSISKQFGAEAKPGLVDFLTSAVPLEQAVIRLDDLTVLPAGSKSQNPPDLLGS
STLAQSLAWSAVKAGMRVMLIDGDLRHPSISKQFGAEAKPGLVDFLTSAVPLEQAVIRLDDLTVLPAGSKSQNPPDLLGS
S                 MLIDGDLR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERMRQLSEKLRDLFDYIVVDSPPVGPVIDAKVLASLADKVVFSVRWRMTPRETVAEHIQYFMQHHKLAGAALSLVDESQA
ERMRQLSEKLRDLFDYIVVDSPPVGPVIDAKVLASLADKVVFSVRWRMTPRETVAEHIQYFMQHHKLAGAALSLVDESQA
                IVVDSPP                                                         
       730       740
....:....|....:....|
PRYGAYSQYYGKYYKKYYQN
PRYGAYSQYYGKYYKKYYQ 
  YGAYSQYYGKYYKKYY  

© 1998-2019