BYKdb

Annotate results for A0A177PV03

A0A177PV03 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A177PV03
DOMAINcd436/628TSPEARDGKTTLSANLAVSIAQSGKKVVLLDADFRKPRMHEIFGVSADVGVASVIAGTAK
LKDAVKPTAVEGLSILPCGPRPANPAELLTSPAFEQLLADLRKEYDFVLVDTPPLLAVSD
PSAVAPRVDGVLLVVRFSKNARPSARRAKEILESMRADVVGVVVNGYGRNGSGYGYDAYR
YGYDQAYGYGSNE
SITEWalker A443/445GKT
SITEWalker A'463/470VLLDADFR
SITEWalker B543/549VLVDTPP
SITEY Cluster609/632YGYDAYRYGYDQAYGYGSNESGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVLGDAASALATKGLSSLEGLSQSEILAVLKGGFGANRVFKDGVTNNVLYLSFRGTNRDDCQVILDAIMQKYDTYLKSKY


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERLNDKTVREVLNIIKELKKGMDETKQKEDAWLAKNPPPTEVSETLLTNLRTRRSNETILRDSLQRQVKDLDHAIKIGQG


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEMFNDMRRVSAHPQTGNTKLDEKLWELYMQMALLQADYGEGHPQIQSVKRQIEAVRALYYGAKAKEVEMPKPGPDDPAR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WHLQSLKRELVAAQANLDEIEKQCNAAEYKARAREEWIKQEARFKESALSARQSYEEVGKRLNELQLSKNFGGVTADVIE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PATPALKVAPVPAKIFIVAMMLGLLLGAGLAFVAEAMDQNFHTLEEIRERLGLAVVGHIPIVEPVGHVPGTPATAMESIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CTYYQPKSVQAEAFRGIRTALYFSLRSGDYKVIQITSPEARDGKTTLSANLAVSIAQSGKKVVLLDADFRKPRMHEIFGV
                                   TSPEARDGKTTLSANLAVSIAQSGKKVVLLDADFRKPRMHEIFGV
                                          GKT                 VLLDADFR          
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SADVGVASVIAGTAKLKDAVKPTAVEGLSILPCGPRPANPAELLTSPAFEQLLADLRKEYDFVLVDTPPLLAVSDPSAVA
SADVGVASVIAGTAKLKDAVKPTAVEGLSILPCGPRPANPAELLTSPAFEQLLADLRKEYDFVLVDTPPLLAVSDPSAVA
                                                              VLVDTPP           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRVDGVLLVVRFSKNARPSARRAKEILESMRADVVGVVVNGYGRNGSGYGYDAYRYGYDQAYGYGSNESGYYHEHEGSSR
PRVDGVLLVVRFSKNARPSARRAKEILESMRADVVGVVVNGYGRNGSGYGYDAYRYGYDQAYGYGSNE            
                                                YGYDAYRYGYDQAYGYGSNESGYY        
       650       660 
....:....|....:....|.
KPANGNGHGGGIVARLFRWLR


© 1998-2019