BYKdb

Annotate results for A0A178FZK5

A0A178FZK5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A178FZK5
DOMAINtad10/263DPIDLKELFFSLIAQWKLIALCVILSLLCALLYLRATPDTYSVDALVQVEENKGTSAALL
GDLSSMIEQKQPAQAEIELLKSRLVLGSVIKNLNLDVKISGTENRFFDRLLSPHDYQTNY
QAKSVIFQDDAKSFEVRKFEVPAYYLDKDLLLDFNASKFTLTDKKTKQILFSAPTNQESQ
YASAHGTWKVAIYTPDPLKGTYNIQKMSLPGAMLAITKNYSVAEKGKLTGILGLNYQGQD
KEHITKVLNSILVA
DOMAINcd539/727SGPAPEVGKSFISTNLATILAQSNKRVLIIDGDMRRGYLHRYFNHDNQPGLAEYLNNTQQ
SLENIIKPTEVHNLEVMTRGKSPVNPSELLSSAKFAAMLEQLSPNYDHIIIDTPPVLAVT
DGIIISQYAGVNLVIARYAKSQMKELELTLNRFEQANVKVNGFILNNIQRGTRGYGYGYN
YAYGYKASK
SITEWalker A546/548GKS
SITEWalker A'566/573LIIDGDMR
SITEWalker B647/653IIIDTPP
SITE-576/-580YLHRY
SITE-618/-620GKS
SITEY Cluster713/723YGYGYNYAYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNEKNSLTEDPIDLKELFFSLIAQWKLIALCVILSLLCALLYLRATPDTYSVDALVQVEENKGTSAALLGDLSSMIEQKQ
         DPIDLKELFFSLIAQWKLIALCVILSLLCALLYLRATPDTYSVDALVQVEENKGTSAALLGDLSSMIEQKQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAQAEIELLKSRLVLGSVIKNLNLDVKISGTENRFFDRLLSPHDYQTNYQAKSVIFQDDAKSFEVRKFEVPAYYLDKDLL
PAQAEIELLKSRLVLGSVIKNLNLDVKISGTENRFFDRLLSPHDYQTNYQAKSVIFQDDAKSFEVRKFEVPAYYLDKDLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDFNASKFTLTDKKTKQILFSAPTNQESQYASAHGTWKVAIYTPDPLKGTYNIQKMSLPGAMLAITKNYSVAEKGKLTGI
LDFNASKFTLTDKKTKQILFSAPTNQESQYASAHGTWKVAIYTPDPLKGTYNIQKMSLPGAMLAITKNYSVAEKGKLTGI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLNYQGQDKEHITKVLNSILVAYSQQNIERRSAETAQTLKFLDEQLPELKQQLDLAEREFNTFRQQYNTVDVTKESELY
LGLNYQGQDKEHITKVLNSILVA                                                         

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTQSITLETQKSQLQQQQAEMAAKYTNEHPAMQQMNAQLGAINKKIGELNETLKQLPDLQRRYLQLYREVEVKTQLYTAL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNSYQQLRIAKAGEIGNVRVVDTAVLPIEPIKPKELIVLALSLFAGGFLGTLVALVRNMMRSGIKDSSQIENELDLPVYA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVPHSPIQESRIKLLKKKKHVPILAIKNGDDIAIESLRSMRTAIHFAMSQAKNNIIMISGPAPEVGKSFISTNLATILAQ
                                                          SGPAPEVGKSFISTNLATILAQ
                                                                 GKS            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNKRVLIIDGDMRRGYLHRYFNHDNQPGLAEYLNNTQQSLENIIKPTEVHNLEVMTRGKSPVNPSELLSSAKFAAMLEQL
SNKRVLIIDGDMRRGYLHRYFNHDNQPGLAEYLNNTQQSLENIIKPTEVHNLEVMTRGKSPVNPSELLSSAKFAAMLEQL
     LIIDGDMR                                                                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPNYDHIIIDTPPVLAVTDGIIISQYAGVNLVIARYAKSQMKELELTLNRFEQANVKVNGFILNNIQRGTRGYGYGYNYA
SPNYDHIIIDTPPVLAVTDGIIISQYAGVNLVIARYAKSQMKELELTLNRFEQANVKVNGFILNNIQRGTRGYGYGYNYA
      IIIDTPP                                                           YGYGYNYA
       730        
....:....|....:...
YGYKASKDKDKTDLVHLN
YGYKASK           
YGY               

© 1998-2019