BYKdb

Annotate results for A0A178GY69

A0A178GY69 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A178GY69
DOMAINtad12/195DFIDIDAALATIRRQWRIVLATIAIAGTIGLAYAATAVPIYSATATLLIDRNNSQVVEQL
STIGGVIEDEASILSQVEVLQSETIGLAVVDNLNLTENQEFRATRASLLSSMLGTVRSLV
NVSQWFSPAKEAVVDDGTLKRALSDRLLQGLSVKRIGRTYALELTYNSTSPALAAQIVNA
VAAA
DOMAINcd556/746VSALPSEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALGRHAGEGLLEVLLEGRN
VRDVLLHDEKTGLAFLPTVVKQRVPHSSELLTSPQMHKLLAEASGVFDYIIVDLPPLGPV
VDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVHIRKKCLGVILNKVDTEKLKLYRAY
GSSEYYYSRYT
SITE-695/-697GKT
SITEWalker A'583/590LLLDADIR
SITEWalker B665/671IIVDLPP
SITEY Cluster732/749YRAYGSSEYYYSRYTRYY
SITEWalker A563/565GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADIDKNAFAADFIDIDAALATIRRQWRIVLATIAIAGTIGLAYAATAVPIYSATATLLIDRNNSQVVEQLSTIGGVIED
           DFIDIDAALATIRRQWRIVLATIAIAGTIGLAYAATAVPIYSATATLLIDRNNSQVVEQLSTIGGVIED

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EASILSQVEVLQSETIGLAVVDNLNLTENQEFRATRASLLSSMLGTVRSLVNVSQWFSPAKEAVVDDGTLKRALSDRLLQ
EASILSQVEVLQSETIGLAVVDNLNLTENQEFRATRASLLSSMLGTVRSLVNVSQWFSPAKEAVVDDGTLKRALSDRLLQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLSVKRIGRTYALELTYNSTSPALAAQIVNAVAAAYLVDKLNSKYEATKRASDWLSDRIAELRQRALDTDLAVQKFRAEH
GLSVKRIGRTYALELTYNSTSPALAAQIVNAVAAA                                             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLIETGNNGLLSDQQLAELNSAQILAQSETARARARVQRIEHILATDDVDAVVTDILDSSVANDLRKKYLESSKIEAEIT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLGKNHVQAVRLRNEMQEYRRLMFQEVSRIAQSYKSDLEVAEARERTLEASVAKATTVSNSASQTQVQLRELQREAETY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNMYQTFLQRYQEAMQQQSFPVTEARVISKAIPPKIPSKPNKPMLLALFMIMGAAAGGGIAMFREFRDRFFRTGEQVRDV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGLEFLGNTPLIPNKPVEEILPKAQESGPAATCPSSVARYAVDHPLSSFAETLRSTRLALDLGIPAKSGARVVGVVSALP
                                                                           VSALP

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALGRHAGEGLLEVLLEGRNVRDVLLHDEKTGLAFLPTVVKQRVP
SEGKSTISINLAQLLAGQGARVLLLDADIRNPGATRALGRHAGEGLLEVLLEGRNVRDVLLHDEKTGLAFLPTVVKQRVP
  GKS                 LLLDADIR                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HSSELLTSPQMHKLLAEASGVFDYIIVDLPPLGPVVDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVHIRKKCLGVI
HSSELLTSPQMHKLLAEASGVFDYIIVDLPPLGPVVDARAMASRIDGFVFVTEWGKTARRAVRNTIENEVHIRKKCLGVI
                        IIVDLPP                                                 
       730       740       750 
....:....|....:....|....:....|.
LNKVDTEKLKLYRAYGSSEYYYSRYTRYYHD
LNKVDTEKLKLYRAYGSSEYYYSRYT     
           YRAYGSSEYYYSRYTRYY  

© 1998-2019