BYKdb

Annotate results for A0A178HI32

A0A178HI32 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A178HI32
DOMAINcd58/249TSSGPWEGKSTIAANVATTMAHLDGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRD
VDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDVTAVFDLVIIDAPPLLPV
TDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGY
GYRDEDIDSEDL
SITEWalker A65/67GKS
SITEWalker A'86/93LMIDCDLR
SITEWalker B167/173VIIDAPP
SITE-120/-126YMDVAQY
SITEY Cluster234/239YYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNFKQRKIDKKNKEQRRGVSLITAADPNHVISEQFRTIRTNIQFAIDAYHLKTLMFTSSGPWEGKSTIAANVATTMAHL
                                                         TSSGPWEGKSTIAANVATTMAHL
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
DGVRVLMIDCDLRKPTVHKTFDIHSRKGLTTYLTDRDVDYMDVAQYVAEVNTYVIPAGPIPPNPAELLSSQRMSDLLEDV
     LMIDCDLR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
TAVFDLVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRLLESVDANVIGAIYNGADGQGMNAYYGYGYR
      VIIDAPP                                                            YYGYGY 
       250 
....:....|.
DEDIDSEDLQS
DEDIDSEDL  

© 1998-2019