BYKdb

Annotate results for A0A178I0Q8

A0A178I0Q8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A178I0Q8
DOMAINtad4/176EEIDLRGILRLLRRQARLIALTVLIGVLGATIIVFSLTPIYSASTLIMVDPSNKNLLDPS
APLLSSSAENARIDSEVEIMRSDNILLKVISDQTLLTDDEFGVSLGLSDRILSFLRLATP
DLPTGEEALNQSLSKLAGAVSVQRRGLTYLISLQVRSRDPAKAAELANATANI
DOMAINcd518/708TSTLPNEGKTTIALALARSYALSGHRTLLIDGDLRKPSVHRHMNFEPQTGLNDFLSQPTS
DANLAALASTDPLSGCTVIFGARRSGTPTDHLLANSRFVDLLDAARKTFDVVVVDTPPIG
PVIDGLYIAPHADVAVLCVRWAHTGQQEAGKVLNALGKAMRPDARLLAVLNQQAGSERSY
LRKYSGYYQEA
SITEWalker A525/527GKT
SITEWalker A'545/552LLIDGDLR
SITEWalker B629/635VVVDTPP
SITEY Cluster697/705YLRKYSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPEEEIDLRGILRLLRRQARLIALTVLIGVLGATIIVFSLTPIYSASTLIMVDPSNKNLLDPSAPLLSSSAENARIDSEV
   EEIDLRGILRLLRRQARLIALTVLIGVLGATIIVFSLTPIYSASTLIMVDPSNKNLLDPSAPLLSSSAENARIDSEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIMRSDNILLKVISDQTLLTDDEFGVSLGLSDRILSFLRLATPDLPTGEEALNQSLSKLAGAVSVQRRGLTYLISLQVRS
EIMRSDNILLKVISDQTLLTDDEFGVSLGLSDRILSFLRLATPDLPTGEEALNQSLSKLAGAVSVQRRGLTYLISLQVRS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDPAKAAELANATANIYIQDQISSKVESVLASRDILQSRVNDARAAIVASEGSFDSFVSGNMDRIIQDSGRTDLAAMQAN
RDPAKAAELANATANI                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRQLTEARQQSALSLDQAQAELTANNWADLVATLESDALSALEQQRQSLANRLAGTAESPTTIDLRAELQRIEAEMRSTA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEQIGQLQSQVAQAQEEEDAMRQRLRQQVLGSSLPPDVLAQLYELQQNAELARAQYQTVLARVQDLDAQATLQIADSRVV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVALTPRAPSFPNRMLIIGLAALASIGLGIGLAFLYENLIGGFTTEEQLENVLKIPVAATVPLARPSVDGQSLADLVVNA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLSMFAESIRRIRAATEQQTNRTSTRGEATRGMVVMMTSTLPNEGKTTIALALARSYALSGHRTLLIDGDLRKPSVHRHM
                                     TSTLPNEGKTTIALALARSYALSGHRTLLIDGDLRKPSVHRHM
                                            GKT                 LLIDGDLR        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NFEPQTGLNDFLSQPTSDANLAALASTDPLSGCTVIFGARRSGTPTDHLLANSRFVDLLDAARKTFDVVVVDTPPIGPVI
NFEPQTGLNDFLSQPTSDANLAALASTDPLSGCTVIFGARRSGTPTDHLLANSRFVDLLDAARKTFDVVVVDTPPIGPVI
                                                                    VVVDTPP     
       650       660       670       680       690       700        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
DGLYIAPHADVAVLCVRWAHTGQQEAGKVLNALGKAMRPDARLLAVLNQQAGSERSYLRKYSGYYQEA
DGLYIAPHADVAVLCVRWAHTGQQEAGKVLNALGKAMRPDARLLAVLNQQAGSERSYLRKYSGYYQEA
                                                        YLRKYSGYY   

© 1998-2019