BYKdb

Annotate results for A0A178IFJ2

A0A178IFJ2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A178IFJ2
DOMAINcd545/740TSTIPGEGKSFVASNLATAFAAHGLRTLIIDGDLRRPVQHRLADAPNTHGLLRWLDKGGK
SGGPLANDPDLDLLRPAPNLFVLRAGGTSRRISELLDNEKLKGLFEQARREFDILVIDTP
PAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMPSGRGS
AAYYSGYGYYGSKHYS
SITE-603/-605GKS
SITEWalker A'572/579LIIDGDLR
SITEWalker B659/665LVIDTPP
SITEY Cluster727/743YYSGYGYYGSKHYSSYY
SITEWalker A552/554GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAETFSKKPVPAAGAWPPQSSSPFGEPPPFAGGSLPRLDIRQILLCIRERWIVAVSLAILVCVLLGVWLLNQPKVFQASA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLLVDRAEKVLGNEMTKVVDDSVGGSKNDPSFDTHLAQITSREMVQRVVASFTPEEKTRVLAAWLDKDDPPLSASQMDGR


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSGLITSGVGVQRQGTTFLIRITCKHREPAMAALVATRFAECYIVYLMDRNASANDSAISFLRAQTEDLRKKAEASERAL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HAYREKSRMVSLEESQNIVVDRMKAISSALTEAQVALLAIEARLQQAESVIAKNSSPLELASITEFSSLASVQSQLDELV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARKAVMAEKYGRRHPAMIDQERSIQALEKLRGDLILTAVANLRNQREKALENERQLQRQLADSEKASLALDRQAVEYNVL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RREAETNRATYTQVLSRLNEASLTAQLGNSNIKIAERARPPTVPLEPNPKKILLSIGFLGVLIVIGYPVGMELLFNRIKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WTDVERYIGLPLLSEFPVLKNLPGDTLNHLVLQDRDPDAGEVVRGLYAQLKLSSRLDAPKTLLVTSTIPGEGKSFVASNL
                                                                TSTIPGEGKSFVASNL
                                                                       GKS      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATAFAAHGLRTLIIDGDLRRPVQHRLADAPNTHGLLRWLDKGGKSGGPLANDPDLDLLRPAPNLFVLRAGGTSRRISELL
ATAFAAHGLRTLIIDGDLRRPVQHRLADAPNTHGLLRWLDKGGKSGGPLANDPDLDLLRPAPNLFVLRAGGTSRRISELL
           LIIDGDLR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DNEKLKGLFEQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMPS
DNEKLKGLFEQARREFDILVIDTPPAGIFPDAFDLVPFASELVYVVRFNHVSRPQVHRVTERFRSTGLEMPGIVLNMMPS
                  LVIDTPP                                                       
       730       740       750   
....:....|....:....|....:....|...
GRGSAAYYSGYGYYGSKHYSSYYKEGQLAARSG
GRGSAAYYSGYGYYGSKHYS             
      YYSGYGYYGSKHYSSYY          

© 1998-2019