BYKdb

Annotate results for A0A178IH18

A0A178IH18 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A178IH18
DOMAINtad9/162ETAALPEFFQVLRQRKFLILLVMALVVGTAAVVTALLPKWYLSTINIRVEKPEGKVVFEN
QANNYYDPYFLQDQFKVIQSPKILNPVIENLGLNRRIAALLGASAPYPTDVTYEYLTKKM
LRVEMPRNTSLLEVNVFSRDAALAAAIANEIARA
DOMAINcd506/693LSAGPGEGKSTTLLRLARAMGEAGARVLLIDSDLRRPTQHQLTGAAKEPGLADLLQGKAT
LDDVTRRSIAPNLDFIPCGSVGGFTLSLLYADRLKALLAGLGKSYDRIMFDAPPIIGVSD
ASVITSLVDDVLLLVQYRRNPQSMVVRAQQIIAGLHKEILGIVLNRVPKNAGDDYGYYTN
NYAYYSSR
SITE-607/-609GKS
SITEWalker A'533/540LLIDSDLR
SITEWalker B613/619IMFDAPP
SITEY Cluster680/690YGYYTNNYAYY
SITEWalker A513/515GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARPDSSSETAALPEFFQVLRQRKFLILLVMALVVGTAAVVTALLPKWYLSTINIRVEKPEGKVVFENQANNYYDPYFLQ
        ETAALPEFFQVLRQRKFLILLVMALVVGTAAVVTALLPKWYLSTINIRVEKPEGKVVFENQANNYYDPYFLQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQFKVIQSPKILNPVIENLGLNRRIAALLGASAPYPTDVTYEYLTKKMLRVEMPRNTSLLEVNVFSRDAALAAAIANEIA
DQFKVIQSPKILNPVIENLGLNRRIAALLGASAPYPTDVTYEYLTKKMLRVEMPRNTSLLEVNVFSRDAALAAAIANEIA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAYSEDRIAFATAEQRAGLDQLRRELAGQERAVATQRDLVEKLRAQLNISGVNLVTPQGGDIEIETLRQMQNTLVALRVD
RA                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGRRARYENFKKIPEADRANLVNSELITDTNIQNLLQAYLVADQNVTRLRSRLGEAHPELITATDNRAKIREQLDAQLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GYENGLEISCKEAEARVAELEKQLEEARARQITSSTDRMRPFEEAVRKLDDETRLLSTVKLVLRQREIDYQVPKRTIEIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTAEPARRAARPSWPLNLTFAFLFGAVLGVGAAVLIEFFDASFRGVADVERRLQRPVLGVIPASATARRPNEDSGDPADA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPFRVLQTNISLARKDAAPGRTLVMLSAGPGEGKSTTLLRLARAMGEAGARVLLIDSDLRRPTQHQLTGAAKEPGLADLL
                         LSAGPGEGKSTTLLRLARAMGEAGARVLLIDSDLRRPTQHQLTGAAKEPGLADLL
                                GKS                 LLIDSDLR                    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGKATLDDVTRRSIAPNLDFIPCGSVGGFTLSLLYADRLKALLAGLGKSYDRIMFDAPPIIGVSDASVITSLVDDVLLLV
QGKATLDDVTRRSIAPNLDFIPCGSVGGFTLSLLYADRLKALLAGLGKSYDRIMFDAPPIIGVSDASVITSLVDDVLLLV
                                                    IMFDAPP                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYRRNPQSMVVRAQQIIAGLHKEILGIVLNRVPKNAGDDYGYYTNNYAYYSSRDVRRRSRRHRSGRDRDDEADARETFTE
QYRRNPQSMVVRAQQIIAGLHKEILGIVLNRVPKNAGDDYGYYTNNYAYYSSR                           
                                       YGYYTNNYAYY                              
   
...
PER


© 1998-2019