BYKdb

Annotate results for A0A178J8K1

A0A178J8K1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A178J8K1
DOMAINtad14/204NLVDLGYYVHLVKSRLTSIVCFTILCTAIAVLIVLSTTPTYTATSTLLIESSQKKAISIE
EVVGIDTTAKEYYLTQFEILKSNQVSKRVIEKLNLVENPEFNSKLNDTSTSLFDDWKAIA
MNIKVIASFIGSPDDVELDQNATDVAYRRVLKEFKSRLTISPIRKTQLVNISFESEDPEL
AAIIANEVGQA
DOMAINcd551/737SSSVPDEGKTTTSIGLAYSFSKLERVLLIDCDLRKGSLATRFSVQKSQPGITNFFLTNAP
IEECIVNIEEGNLDVLPSGMHVNNPQEILSSRGFKELLDDLSDRYDRIIIDTPPILPVKD
AFIVGKLSKGIILVVKANSTTSSVYKHTTTLFSEHQIKIDGVILNKVLIPKKGKHTYQEY
SEYAREA
SITEWalker A558/560GKT
SITEWalker A'577/584LLIDCDLR
SITEWalker B658/664IIIDTPP
SITEY Cluster727/733YQEYSEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPLNLKGDHQERENLVDLGYYVHLVKSRLTSIVCFTILCTAIAVLIVLSTTPTYTATSTLLIESSQKKAISIEEVVGIDT
             NLVDLGYYVHLVKSRLTSIVCFTILCTAIAVLIVLSTTPTYTATSTLLIESSQKKAISIEEVVGIDT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAKEYYLTQFEILKSNQVSKRVIEKLNLVENPEFNSKLNDTSTSLFDDWKAIAMNIKVIASFIGSPDDVELDQNATDVAY
TAKEYYLTQFEILKSNQVSKRVIEKLNLVENPEFNSKLNDTSTSLFDDWKAIAMNIKVIASFIGSPDDVELDQNATDVAY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRVLKEFKSRLTISPIRKTQLVNISFESEDPELAAIIANEVGQAFIENSLESKLVANEQATSWINQRLTELKQQLDRSER
RRVLKEFKSRLTISPIRKTQLVNISFESEDPELAAIIANEVGQA                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLDFLERQELIDDSGIIALTSSELSNLTERIARASDKRIETQALYNALKGNKNVDVSTLASISLISNHPQIRDIRQAES


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAKIVSELSKRYGPKHDKMIQANAQLKSIQNRASSLILKLINGIEKELTSAINQEKLLKNELSSKKEEFQALSVVKREY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSLKREVDTNAKLYDLFLTRQKETSATSDFSSANARFSDYALVPESPSKPNKKLVVLISFFVSTGLAIALVVIQDALNKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IENARDFENKLRMLPTGSLPIVRDKMHKNEHIALNVLKDKKFSFFKEATDSIRTSLLLSLRNEDRKVLAVSSSVPDEGKT
                                                                      SSSVPDEGKT
                                                                             GKT
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TTSIGLAYSFSKLERVLLIDCDLRKGSLATRFSVQKSQPGITNFFLTNAPIEECIVNIEEGNLDVLPSGMHVNNPQEILS
TTSIGLAYSFSKLERVLLIDCDLRKGSLATRFSVQKSQPGITNFFLTNAPIEECIVNIEEGNLDVLPSGMHVNNPQEILS
                LLIDCDLR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRGFKELLDDLSDRYDRIIIDTPPILPVKDAFIVGKLSKGIILVVKANSTTSSVYKHTTTLFSEHQIKIDGVILNKVLIP
SRGFKELLDDLSDRYDRIIIDTPPILPVKDAFIVGKLSKGIILVVKANSTTSSVYKHTTTLFSEHQIKIDGVILNKVLIP
                 IIIDTPP                                                        
       730       
....:....|....:..
KKGKHTYQEYSEYAREA
KKGKHTYQEYSEYAREA
      YQEYSEY    

© 1998-2019