BYKdb

Annotate results for A0A178Y3U0

A0A178Y3U0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A178Y3U0
DOMAINtad18/162ALLDLREIIDFLFRRWKLISCIAAITLGAFVGASYVVTPSYTAVAEILLDAPKDYISAQE
LAPEFRDNTTFVESQISVLRSASLLQKVVDGQKLTEDENIDGSALEWLKGALEVSRVGLA
DVIELSVTSHDPEQATALANAVADV
DOMAINcd510/697TSAMQGEGKTTLALSLAYSAVADGERVLVVDADLRMSAATAFFGMGENVGLVDLLSLPMK
PVDAIHLDERSGIHVLPAGAKTLNPPALIASTRMHAVLEELRGNFDTVIIDAPPVGPAAD
ASILERYVDKVVFVVKWRETSREAVFEGIRHLGGRTRIAGIALTMVDEPKLPRYGRYVSI
EGNASSGY
SITEWalker A517/519GKT
SITEWalker A'537/544LVVDADLR
SITEWalker B617/623VIIDAPP
SITEY Cluster683/698YGRYVSIEGNASSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQSSTDRMVATPVPPEPALLDLREIIDFLFRRWKLISCIAAITLGAFVGASYVVTPSYTAVAEILLDAPKDYISAQELAP
                 ALLDLREIIDFLFRRWKLISCIAAITLGAFVGASYVVTPSYTAVAEILLDAPKDYISAQELAP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFRDNTTFVESQISVLRSASLLQKVVDGQKLTEDENIDGSALEWLKGALEVSRVGLADVIELSVTSHDPEQATALANAVA
EFRDNTTFVESQISVLRSASLLQKVVDGQKLTEDENIDGSALEWLKGALEVSRVGLADVIELSVTSHDPEQATALANAVA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVYVLDRIESRYEGAKKASTWLSERAAVLREELSRSEEAVQKFRMEHNLLATTHGSLTGQQLSELNIALINARAELAAKR
DV                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKYEQAEKLLRTGGDTQTIPDVLQSVVVTALRAQQAVVARKETDLSLKYGELHPEVTAAQAERRDIEEQISAEIQRLIGN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKNEVEAAEAREVALSRALASVSNQSEAEDQVAVQLRDLERIAAANKELFETFLSRAKIAEEKSTLLNSGVRVITRAEVP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGPSFPNRPLFAALGLVFGFAIGGAGALLRELFAPGFMAKRQVEEALAVPVLASLPRMTEWSGASKTRAQPVAYLERKPL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRYSEAVRRLRLGIDGVPETEPQPQLILVTSAMQGEGKTTLALSLAYSAVADGERVLVVDADLRMSAATAFFGMGENVGL
                             TSAMQGEGKTTLALSLAYSAVADGERVLVVDADLRMSAATAFFGMGENVGL
                                    GKT                 LVVDADLR                
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDLLSLPMKPVDAIHLDERSGIHVLPAGAKTLNPPALIASTRMHAVLEELRGNFDTVIIDAPPVGPAADASILERYVDKV
VDLLSLPMKPVDAIHLDERSGIHVLPAGAKTLNPPALIASTRMHAVLEELRGNFDTVIIDAPPVGPAADASILERYVDKV
                                                        VIIDAPP                 
       650       660       670       680       690       700
....:....|....:....|....:....|....:....|....:....|....:....|
VFVVKWRETSREAVFEGIRHLGGRTRIAGIALTMVDEPKLPRYGRYVSIEGNASSGYYRN
VFVVKWRETSREAVFEGIRHLGGRTRIAGIALTMVDEPKLPRYGRYVSIEGNASSGY   
                                          YGRYVSIEGNASSGYY  

© 1998-2019