BYKdb

Annotate results for A0A179BVT4

A0A179BVT4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A179BVT4
DOMAINtad30/204DNFDLAAAFRLVRRRMIMIIAITALLMAPTVIIISGLKPAYQAWARLIIHQPLATSLGAD
DSHSDLLDAKSETERLLSRSIAERVVHELRFNVRPEFNPALREISFIDRIRAMLRGLFDT
EKPTSPVRDNIDAIIPEYFRALGVWHEDKSDVIQISFTSNDPELAAAVPNRIISI
DOMAINcd542/727TSAHSGEGKSLVARSLAIELAAAAIPVLLVDGDLRRGKLDSFFRSGLMYGLNEFLNGQAD
LRDIVYRHPSGIDFIPSGRFSLQRRTRSNGLAEIIEMAGAAGQIVIFDSAPVLASTDTVH
LTALAERTLAVVRWGKTSRRAVEFSLQQMKSSRNSETVVAINNVNPKSHALYNFSDSELF
SKSLMK
SITE-676/-678GKT
SITEWalker A'569/576LLVDGDLR
SITEWalker B646/652VIFDSAP
SITEY Cluster728/729YY
SITEWalker A549/551GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTISTVPPDRNLPISQMRYDPRFQVETKADNFDLAAAFRLVRRRMIMIIAITALLMAPTVIIISGLKPAYQAWARLIIHQ
                             DNFDLAAAFRLVRRRMIMIIAITALLMAPTVIIISGLKPAYQAWARLIIHQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLATSLGADDSHSDLLDAKSETERLLSRSIAERVVHELRFNVRPEFNPALREISFIDRIRAMLRGLFDTEKPTSPVRDNI
PLATSLGADDSHSDLLDAKSETERLLSRSIAERVVHELRFNVRPEFNPALREISFIDRIRAMLRGLFDTEKPTSPVRDNI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAIIPEYFRALGVWHEDKSDVIQISFTSNDPELAAAVPNRIISIYLDERKDSLGSRLDSAQKWIRQRITEQQARADIARD
DAIIPEYFRALGVWHEDKSDVIQISFTSNDPELAAAVPNRIISI                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AARNYQESMDVVSKEDAQDERIKSIIEVTGREGKIEESRLEVKATISTLEATDNASVAAENIAVPDNISTKQRDLRGQEQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLARLLQTYDGNAETVVDLRGKIQESRADLNLATKQYLQTMRAKLAALDHEAKSIQSILAEAHEKRTRDALVQSELTRLQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HIADLEQTSLDKLEDQRRDLAAKAMLPGAELEVLSPASVPIAAQGRGRLFYLVGALLAAISGAVTAAFVIEMSDRTVRSF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQIAAMARTIPAGLIPRLARWENSKTMFEHMPVPMFDEAIRTVVLSLKQSNGGKSPSSIVVTSAHSGEGKSLVARSLAIE
                                                             TSAHSGEGKSLVARSLAIE
                                                                    GKS         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAAAAIPVLLVDGDLRRGKLDSFFRSGLMYGLNEFLNGQADLRDIVYRHPSGIDFIPSGRFSLQRRTRSNGLAEIIEMAG
LAAAAIPVLLVDGDLRRGKLDSFFRSGLMYGLNEFLNGQADLRDIVYRHPSGIDFIPSGRFSLQRRTRSNGLAEIIEMAG
        LLVDGDLR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAGQIVIFDSAPVLASTDTVHLTALAERTLAVVRWGKTSRRAVEFSLQQMKSSRNSETVVAINNVNPKSHALYNFSDSEL
AAGQIVIFDSAPVLASTDTVHLTALAERTLAVVRWGKTSRRAVEFSLQQMKSSRNSETVVAINNVNPKSHALYNFSDSEL
     VIFDSAP                                                                    
       730  
....:....|..
FSKSLMKYYSLK
FSKSLMK     
       YY   

© 1998-2019