BYKdb

Annotate results for A0A179CLV7

A0A179CLV7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A179CLV7
DOMAINcd61/252MSALPSEGKSTVSANLAVTWAEEKKRVLLVDADLRRPTVHRTFKVSNRYGLSNIITSSAS
TVDISEMIDKTEVENLDVLTSGPTPPNPAELLGSERLSQLLDFLRERYDFIILDAPPVDT
VTDGQIVGTRADGVALVTPQGIATKDAVMRAVKLLQRVNANILGVIMNRFTAQEAGGYYG
GYYGNYYGGSYY
SITEWalker A68/70GKS
SITEWalker A'88/95LLVDADLR
SITEWalker B171/177IILDAPP
SITEY Cluster238/252YYGGYYGNYYGGSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFDRFKKNKTKLDEDSMKYGVALITRDDPKSGISEQYRTIRTNLKFSFLDPDFKILAVMSALPSEGKSTVSANLAVTW
                                                            MSALPSEGKSTVSANLAVTW
                                                                   GKS          
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEEKKRVLLVDADLRRPTVHRTFKVSNRYGLSNIITSSASTVDISEMIDKTEVENLDVLTSGPTPPNPAELLGSERLSQL
AEEKKRVLLVDADLRRPTVHRTFKVSNRYGLSNIITSSASTVDISEMIDKTEVENLDVLTSGPTPPNPAELLGSERLSQL
       LLVDADLR                                                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDFLRERYDFIILDAPPVDTVTDGQIVGTRADGVALVTPQGIATKDAVMRAVKLLQRVNANILGVIMNRFTAQEAGGYYG
LDFLRERYDFIILDAPPVDTVTDGQIVGTRADGVALVTPQGIATKDAVMRAVKLLQRVNANILGVIMNRFTAQEAGGYYG
          IILDAPP                                                            YYG
       250       260         
....:....|....:....|....:....
GYYGNYYGGSYYGTDDSSSRKGSKKRGKK
GYYGNYYGGSYY                 
GYYGNYYGGSYY                 
© 1998-2019