BYKdb

Annotate results for A0A181C909

A0A181C909 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A181C909
DOMAINtad8/182VGLVIRQTVRAFLRHRLLFVLTVLGVLVAGGAVMMTLKPRYTATATVVVSGRAQQDPLAP
NGQQQNQAPPDDSLVQTEAAMIHSRDVAAAVLAQLPPPAAAPHVGLRDRLCHMGLGFLCH
AAQPVDPAVQRARDEDAFLNNLTITPEAHTQILDINVVDGDAARAAALADAVVTN
DOMAINcd528/720TSAGPEEGKSTLALWMATIARRGGQKVLVIDADHRRGMLDQYLTDVTTGRPSLGMSDLVT
TGARVEEVIRTDPDTGFDYIPAGRTMEHAFSPVEIRRLRAMLVELKRTYELIIIDCPPLL
GLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEASGAPLAGVVATMVEDNAMDVMG
YSYGNRDIKILSR
SITEWalker A535/537GKS
SITEWalker A'555/562LVIDADHR
SITEWalker B639/645IIIDCPP
SITEY Cluster708/710YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSWTAQDVGLVIRQTVRAFLRHRLLFVLTVLGVLVAGGAVMMTLKPRYTATATVVVSGRAQQDPLAPNGQQQNQAPPDDS
       VGLVIRQTVRAFLRHRLLFVLTVLGVLVAGGAVMMTLKPRYTATATVVVSGRAQQDPLAPNGQQQNQAPPDDS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVQTEAAMIHSRDVAAAVLAQLPPPAAAPHVGLRDRLCHMGLGFLCHAAQPVDPAVQRARDEDAFLNNLTITPEAHTQIL
LVQTEAAMIHSRDVAAAVLAQLPPPAAAPHVGLRDRLCHMGLGFLCHAAQPVDPAVQRARDEDAFLNNLTITPEAHTQIL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DINVVDGDAARAAALADAVVTNYQRLALARQTADINRVAAWLDSRTAELRQRWMDAVEKANAFDTAHGLTNTSEGSTSSP
DINVVDGDAARAAALADAVVTN                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIERQIADTAANLSQAQGRLAAAQARADALRDAASRGDARAAVALSQEPILVSTANALMQLQSTRQEEAATYGPQHPRLR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALDQQIAVTRASLAAETQAALNSIREDQISARAEVDRLNENLDLLRQKAGGQSAPQAEYRTLDQEAQSARTVYETFLEHA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEVVDRAALLQPPISLVSHASAPDVPSFPNRRKIGMGLVAVALAAGAGIVLLRDYFTAGFTEIERLRAAVPLPLMAVIPK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRARTEQGVRRHVLDHPYSRATEAVRSLVMQLSMRVHDGGQPLCLAITSAGPEEGKSTLALWMATIARRGGQKVLVIDAD
                                               TSAGPEEGKSTLALWMATIARRGGQKVLVIDAD
                                                      GKS                 LVIDAD
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HRRGMLDQYLTDVTTGRPSLGMSDLVTTGARVEEVIRTDPDTGFDYIPAGRTMEHAFSPVEIRRLRAMLVELKRTYELII
HRRGMLDQYLTDVTTGRPSLGMSDLVTTGARVEEVIRTDPDTGFDYIPAGRTMEHAFSPVEIRRLRAMLVELKRTYELII
HR                                                                            II
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEASGAPLAGVVATMVEDNAMDVMGYSYGNRDIKILSR
IDCPPLLGLSDALVHANMADQVIFVCRWKSTAQRAVMACLERLEASGAPLAGVVATMVEDNAMDVMGYSYGNRDIKILSR
IDCPP                                                              YSY          
    
....
FDEK


© 1998-2019