BYKdb

Annotate results for A0A181X2I0

A0A181X2I0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A181X2I0
DOMAINtad14/250DEIDLRRLVGELIDHRKLILSVTSLFTLIALVYALFATPIYQADALVQVEQKQGNALLNS
LSQVLPDSQPQSAPEIALLRSRMILGKTVDDLNLQAKIEEDYFPVFGRGLARLLGNKPNN
LNISRLYLSIPGEEVPEIDVKILDNDRFIVTGEGIEITGKVGQLIEAKGLSLLVSEIDAE
PGTTFTVSYISRLKAITNLQDNLVIADEGKDTGILTLSLTGDDQTQIKNIIDSISTN
DOMAINcd531/719TGASPNAGKTFISSNLAEVISQTGKKVLFLDADLRKGYTHKLFNTDNNSGLSEILSGKIP
VEQAVKTLPKIGFDYISRGMVPPNPAELLMHKRFGELIDWANEHYDLVIVDTPPILAVTD
AAVIGNYAGTTLLVARFEQNTAKEIEVSIKRFEQSGVNIKGCILNGIVKKASNYYGYGYN
HYGYTYTDK
SITEWalker A538/540GKT
SITEWalker A'558/565LFLDADLR
SITEWalker B638/644VIVDTPP
SITEY Cluster704/716YYGYGYNHYGYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSAKNKTAVKDPDEIDLRRLVGELIDHRKLILSVTSLFTLIALVYALFATPIYQADALVQVEQKQGNALLNSLSQVLPD
             DEIDLRRLVGELIDHRKLILSVTSLFTLIALVYALFATPIYQADALVQVEQKQGNALLNSLSQVLPD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQPQSAPEIALLRSRMILGKTVDDLNLQAKIEEDYFPVFGRGLARLLGNKPNNLNISRLYLSIPGEEVPEIDVKILDNDR
SQPQSAPEIALLRSRMILGKTVDDLNLQAKIEEDYFPVFGRGLARLLGNKPNNLNISRLYLSIPGEEVPEIDVKILDNDR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIVTGEGIEITGKVGQLIEAKGLSLLVSEIDAEPGTTFTVSYISRLKAITNLQDNLVIADEGKDTGILTLSLTGDDQTQI
FIVTGEGIEITGKVGQLIEAKGLSLLVSEIDAEPGTTFTVSYISRLKAITNLQDNLVIADEGKDTGILTLSLTGDDQTQI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNIIDSISTNYLAQNIARQAAQDAKSLEFLNEQLPKVRSDLDLAEDKLNGYRQQKDSVDLSLEAKAVLDQIVNVDNQLNE
KNIIDSISTN                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTIRESEVSQLFTKEHPTYKALMEKRKTLQDEKNKLNKRVSAMPETQQEVLRLSRDVDSGRAVYMQLLNRQQELSIAKSS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGNVRIIDNAITQPKPVKPNKVLIILLGLVIGLFISVGLVLARVVLRKGIESPEQLEELGISVYASVPVSEEFAKRVER


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSKMKSKKLDEAAVFLAVENPADLAIESIRGLRTSLHFAMMEARNNVLMITGASPNAGKTFISSNLAEVISQTGKKVLFL
                                                  TGASPNAGKTFISSNLAEVISQTGKKVLFL
                                                         GKT                 LFL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRKGYTHKLFNTDNNSGLSEILSGKIPVEQAVKTLPKIGFDYISRGMVPPNPAELLMHKRFGELIDWANEHYDLVIV
DADLRKGYTHKLFNTDNNSGLSEILSGKIPVEQAVKTLPKIGFDYISRGMVPPNPAELLMHKRFGELIDWANEHYDLVIV
DADLR                                                                        VIV
       650       660       670       680       690       700       710         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
DTPPILAVTDAAVIGNYAGTTLLVARFEQNTAKEIEVSIKRFEQSGVNIKGCILNGIVKKASNYYGYGYNHYGYTYTDK
DTPPILAVTDAAVIGNYAGTTLLVARFEQNTAKEIEVSIKRFEQSGVNIKGCILNGIVKKASNYYGYGYNHYGYTYTDK
DTPP                                                           YYGYGYNHYGYTY   

© 1998-2019