BYKdb

Annotate results for A0A181Z7W1

A0A181Z7W1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A181Z7W1
DOMAINtad30/166RRVELRDYITVLRKGWVLILVLALVGVAAAAGFSVLKQPVYSASAQVFVSTQTSGSASDL
AQGNTFTQQRVLTYSNLVTTPIVLLPVISSLKLDMSADDLAKLVTADAPTNTTLIAITVN
ETDPVQAADIANATSQS
DOMAINcd298/487TSSVQSEGKSTTVANLAIALDSAGYKVILIDADLRRPRVAQYMDLEGGAGLTDVLIGRAE
LEDVAVPWGRGNMVVLPAGEIPPNPSELLGSQAMSMLIERLEAQFDYVLFDAPPLLPVTD
AAILSKKASGAIVVVASGRTMKGQLAGAVQSLENVGAPIAGFVMTMMPTKGPGAYGYGRY
GYAYGYGTDE
SITEWalker A305/307GKS
SITEWalker A'325/332ILIDADLR
SITEWalker B405/411VLFDAPP
SITEY Cluster472/483YGYGRYGYAYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MWQYFPADCWENPGSLARGTARPASHGEGRRVELRDYITVLRKGWVLILVLALVGVAAAAGFSVLKQPVYSASAQVFVST
                             RRVELRDYITVLRKGWVLILVLALVGVAAAAGFSVLKQPVYSASAQVFVST

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTSGSASDLAQGNTFTQQRVLTYSNLVTTPIVLLPVISSLKLDMSADDLAKLVTADAPTNTTLIAITVNETDPVQAADIA
QTSGSASDLAQGNTFTQQRVLTYSNLVTTPIVLLPVISSLKLDMSADDLAKLVTADAPTNTTLIAITVNETDPVQAADIA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NATSQSLTNVVQNIEATDANGASTVKLTRVKEAQVPSTPISPNVPVNVVLGLLVGLALGVGLAVLRETLDNRVRTEADIE
NATSQS                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KISDKPIVGGIAFDNKASERPLIVQVDPRSPRAESFRTLRTNLQFVDIGSDARTFVMTSSVQSEGKSTTVANLAIALDSA
                                                         TSSVQSEGKSTTVANLAIALDSA
                                                                GKS             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GYKVILIDADLRRPRVAQYMDLEGGAGLTDVLIGRAELEDVAVPWGRGNMVVLPAGEIPPNPSELLGSQAMSMLIERLEA
GYKVILIDADLRRPRVAQYMDLEGGAGLTDVLIGRAELEDVAVPWGRGNMVVLPAGEIPPNPSELLGSQAMSMLIERLEA
    ILIDADLR                                                                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFDYVLFDAPPLLPVTDAAILSKKASGAIVVVASGRTMKGQLAGAVQSLENVGAPIAGFVMTMMPTKGPGAYGYGRYGYA
QFDYVLFDAPPLLPVTDAAILSKKASGAIVVVASGRTMKGQLAGAVQSLENVGAPIAGFVMTMMPTKGPGAYGYGRYGYA
    VLFDAPP                                                            YGYGRYGYA
       490       500       510
....:....|....:....|....:....|
YGYGTDEDEAPKPPKQARRGRVGALRKAER
YGYGTDE                       
YGY                           
© 1998-2019