BYKdb

Annotate results for A0A181Z8L4

A0A181Z8L4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A181Z8L4
DOMAINtad1/137MNHFVVARALLSGWWIVLAVSIAGGGVALVVTSTTPPTFRASTSYYVSVAGQESASAGEI
AQGSTAAQQKIKSYTVLASSPRVLEQVIAALRLDTTPAALGRRVTSVVSTGTVIIEISVT
DGDARAAARIAAATGRV
DOMAINcd266/454TSPRPAEGKTTTTLNLAIALAQSDVRTVVVDADLRRPNVASTLDLEGAVGLTDLLVGRAE
LDDVLQEWGFDAFSVLPAGTIPPNPSELIGSAAMEQVIADLTERFDVVLVDTPPVLAVTD
AALVSTLVSTTLLVAAAGQTKRSDVRLAVTALTRVGERVDGVVLTKSRRPVADGYYARPG
TTTSAPIAL
SITEWalker A273/275GKT
SITEWalker A'293/300VVVDADLR
SITEWalker B373/379VLVDTPP
SITEY Cluster440/441YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNHFVVARALLSGWWIVLAVSIAGGGVALVVTSTTPPTFRASTSYYVSVAGQESASAGEIAQGSTAAQQKIKSYTVLASS
MNHFVVARALLSGWWIVLAVSIAGGGVALVVTSTTPPTFRASTSYYVSVAGQESASAGEIAQGSTAAQQKIKSYTVLASS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRVLEQVIAALRLDTTPAALGRRVTSVVSTGTVIIEISVTDGDARAAARIAAATGRVLAEVVSEIEPRTTSGEPSVRLER
PRVLEQVIAALRLDTTPAALGRRVTSVVSTGTVIIEISVTDGDARAAARIAAATGRV                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSEASVPTAPIAPRTSVDLALGFAAGLAFGTGLALLRAAADTRVRSAEDIDADVPLIGEIGMDPEASRQPLIARDEGTTT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAEAFRSLRTNLQFLRTGGVSTIAVTSPRPAEGKTTTTLNLAIALAQSDVRTVVVDADLRRPNVASTLDLEGAVGLTDLL
                         TSPRPAEGKTTTTLNLAIALAQSDVRTVVVDADLRRPNVASTLDLEGAVGLTDLL
                                GKT                 VVVDADLR                    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGRAELDDVLQEWGFDAFSVLPAGTIPPNPSELIGSAAMEQVIADLTERFDVVLVDTPPVLAVTDAALVSTLVSTTLLVA
VGRAELDDVLQEWGFDAFSVLPAGTIPPNPSELIGSAAMEQVIADLTERFDVVLVDTPPVLAVTDAALVSTLVSTTLLVA
                                                    VLVDTPP                     
       410       420       430       440       450        
....:....|....:....|....:....|....:....|....:....|....:...
AAGQTKRSDVRLAVTALTRVGERVDGVVLTKSRRPVADGYYARPGTTTSAPIALRSTS
AAGQTKRSDVRLAVTALTRVGERVDGVVLTKSRRPVADGYYARPGTTTSAPIAL    
                                       YY                 
© 1998-2019