BYKdb

Annotate results for A0A192F4W5

A0A192F4W5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A192F4W5
DOMAINcd15/196TSEKPSSGKSTVTANIATTYAQAGYKTLIIDGDMRKPTQQYIFDLTNFNGLSNFIIGKAL
SKDAIKETHIENLSVLTSGPVPPNPSELITSEKFTELFNKLSEEFDCILIDTPPVTTVTD
AQLYAQNVRDCILIIDITANDKSEVKKAKELLEKSGGKVIGAVLNKATIDKGSNYYYYYG
DE
SITEWalker A22/24GKS
SITEWalker A'42/49LIIDGDMR
SITEWalker B122/128ILIDTPP
SITE-34/-39YAQAGY
SITEY Cluster189/193YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFSNANSEIKSLLITSEKPSSGKSTVTANIATTYAQAGYKTLIIDGDMRKPTQQYIFDLTNFNGLSNFIIGKALSKDAIK
              TSEKPSSGKSTVTANIATTYAQAGYKTLIIDGDMRKPTQQYIFDLTNFNGLSNFIIGKALSKDAIK
                     GKS                 LIIDGDMR                               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETHIENLSVLTSGPVPPNPSELITSEKFTELFNKLSEEFDCILIDTPPVTTVTDAQLYAQNVRDCILIIDITANDKSEVK
ETHIENLSVLTSGPVPPNPSELITSEKFTELFNKLSEEFDCILIDTPPVTTVTDAQLYAQNVRDCILIIDITANDKSEVK
                                         ILIDTPP                                
       170       180       190      
....:....|....:....|....:....|....:.
KAKELLEKSGGKVIGAVLNKATIDKGSNYYYYYGDE
KAKELLEKSGGKVIGAVLNKATIDKGSNYYYYYGDE
                            YYYYY   
© 1998-2019