BYKdb

Annotate results for A0A192H246

A0A192H246 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A192H246
DOMAINcd58/247TSAGPSEGKSTVSSNLAVTWAGQGKNVLLVDADLRRPTVHQTFQVSNSQGLTTLLTNPKL
NLDQAITETAIDHLYVLPSGPIPPNPAELLATERMNHLIEALKEHFDLVLFDVPPVISVT
DTQILASKVDGTILVTPQGIVEKAAILKAKELLDKVHARILGTVMNRVTPQNSGGYYGGY
YGGYYGTDDK
SITEWalker A65/67GKS
SITEWalker A'85/92LLVDADLR
SITEWalker B166/172VLFDVPP
SITEY Cluster233/242YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFRRKEKKLEDKSMKYGVDLYTLSNPTSTIAEQFKTIRTNIQFSMIDRKLETLLVTSAGPSEGKSTVSSNLAVTWAGQ
                                                         TSAGPSEGKSTVSSNLAVTWAGQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKNVLLVDADLRRPTVHQTFQVSNSQGLTTLLTNPKLNLDQAITETAIDHLYVLPSGPIPPNPAELLATERMNHLIEALK
GKNVLLVDADLRRPTVHQTFQVSNSQGLTTLLTNPKLNLDQAITETAIDHLYVLPSGPIPPNPAELLATERMNHLIEALK
    LLVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EHFDLVLFDVPPVISVTDTQILASKVDGTILVTPQGIVEKAAILKAKELLDKVHARILGTVMNRVTPQNSGGYYGGYYGG
EHFDLVLFDVPPVISVTDTQILASKVDGTILVTPQGIVEKAAILKAKELLDKVHARILGTVMNRVTPQNSGGYYGGYYGG
     VLFDVPP                                                            YYGGYYGG
        
....:...
YYGTDDKK
YYGTDDK 
YY      
© 1998-2019