BYKdb

Annotate results for A0A192INN4

A0A192INN4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A192INN4
DOMAINtad30/238PMVNFRQVFTILWRRKWIIAAIVIMGMLMAYYWLQSQTPLYSAASEVVIGIRDEQVTGIQ
GVVQGETQDFYFNETQAAIIASSQVAETVAARLDLFENPDRLYWDAGGSVTAGFSLKATI
KSILPDPVVEGVRGVLNKFRGGSQTDENTSVLASMTPEELAEFEREHVKRTLLDGLSVDP
SERARTIAIRFISDRPAFAAEVANAFAQA
DOMAINcd584/772TSSVPAEGKTSTAVSVARAAAKAGQRTILVDCDLRKPSVHESLRVPNGQGVVEILTGAAD
LNDAIEIDLKSGLHYITAGAKAPNPPDALGSAAMRQLIGELESRYDLVILDTPPVLPVSD
SLVLLRNVDKTVFLVRWGSTRREAVLAGIRQVQEANGDLAGVAMTRVDIRRHQKYNYSDS
YFYYRGYGK
SITEWalker A591/593GKT
SITEWalker A'611/618ILVDCDLR
SITEWalker B691/697VILDTPP
SITEY Cluster758/774YNYSDSYFYYRGYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MANVSYLDSARPDEMSDAPSFVDSGRGDSPMVNFRQVFTILWRRKWIIAAIVIMGMLMAYYWLQSQTPLYSAASEVVIGI
                             PMVNFRQVFTILWRRKWIIAAIVIMGMLMAYYWLQSQTPLYSAASEVVIGI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDEQVTGIQGVVQGETQDFYFNETQAAIIASSQVAETVAARLDLFENPDRLYWDAGGSVTAGFSLKATIKSILPDPVVEG
RDEQVTGIQGVVQGETQDFYFNETQAAIIASSQVAETVAARLDLFENPDRLYWDAGGSVTAGFSLKATIKSILPDPVVEG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRGVLNKFRGGSQTDENTSVLASMTPEELAEFEREHVKRTLLDGLSVDPSERARTIAIRFISDRPAFAAEVANAFAQAYV
VRGVLNKFRGGSQTDENTSVLASMTPEELAEFEREHVKRTLLDGLSVDPSERARTIAIRFISDRPAFAAEVANAFAQA  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESTRTEKSDATSRASDFLRDEVELLKIQYQQSEQALEQFSRETGYVSQGDRLSLIEEQVAEFNRQLVEARQELAEAEARN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQVQRLLEEEGGIETVASVLDSPLIGRLREQEAEVVREIAELRTQLRDRHPRLLLKRAELEDLQNKIRGEINKIVIGQNN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLELSRVRVRNLEQEVAILQAQVQRQSDAEVTLQALRSERDANKQLYETVLGRFNEINLQERSPQQANARIITPASTPLF


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSFPRKSLTLAAALVGSAMLAVMVVFLIEYMDSGFRSLQQLQQSIYVPALGIVPRLSVMEARRYTPEEFVLEQPNSLYAE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIRTIRTSLMLSSIDRPPKSVMFTSSVPAEGKTSTAVSVARAAAKAGQRTILVDCDLRKPSVHESLRVPNGQGVVEILTG
                       TSSVPAEGKTSTAVSVARAAAKAGQRTILVDCDLRKPSVHESLRVPNGQGVVEILTG
                              GKT                 ILVDCDLR                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AADLNDAIEIDLKSGLHYITAGAKAPNPPDALGSAAMRQLIGELESRYDLVILDTPPVLPVSDSLVLLRNVDKTVFLVRW
AADLNDAIEIDLKSGLHYITAGAKAPNPPDALGSAAMRQLIGELESRYDLVILDTPPVLPVSDSLVLLRNVDKTVFLVRW
                                                  VILDTPP                       
       730       740       750       760       770      
....:....|....:....|....:....|....:....|....:....|....:.
GSTRREAVLAGIRQVQEANGDLAGVAMTRVDIRRHQKYNYSDSYFYYRGYGKYYGA
GSTRREAVLAGIRQVQEANGDLAGVAMTRVDIRRHQKYNYSDSYFYYRGYGK    
                                     YNYSDSYFYYRGYGKYY  

© 1998-2019