BYKdb

Annotate results for A0A192WQ77

A0A192WQ77 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A192WQ77
DOMAINtad17/170QTAHFREYWRVIWNGRYTIAAVFVVVVALAAVKTFLATPVYRAVAVIEVQPKSSSITPGQ
DVSGLGSAGYGWFAENKYHNTQVEIMRSHDIAERVVDTLGLRSDPFFEAAHNPVQTFRSM
IRVDPRRETGLIEVSIEGKDPEQITAWVNEVARA
DOMAINcd503/696TSSGPQEGKSTTISRLGRALATGGEKVVIIDCDLRRPTQQVHNEVPRSPGLTNFLAAPES
DKDWRPFAKETDTATLQIIPAGPTPPSPPDMLTSDRFLWLVNELQKEYDWVLIDSPPAAA
LSDAPLLATLAHMVVMVVRHNHTDRDVAIRAMTQVKNVNEHLIGAVLNNVDIDKSFSKDL
YYTGYYYYSSDDGE
SITEWalker A510/512GKS
SITEWalker A'530/537VIIDCDLR
SITEWalker B613/619VLIDSPP
SITEY Cluster683/690YYTGYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVDTTKAAGSGNASPDQTAHFREYWRVIWNGRYTIAAVFVVVVALAAVKTFLATPVYRAVAVIEVQPKSSSITPGQDVSG
                QTAHFREYWRVIWNGRYTIAAVFVVVVALAAVKTFLATPVYRAVAVIEVQPKSSSITPGQDVSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGSAGYGWFAENKYHNTQVEIMRSHDIAERVVDTLGLRSDPFFEAAHNPVQTFRSMIRVDPRRETGLIEVSIEGKDPEQI
LGSAGYGWFAENKYHNTQVEIMRSHDIAERVVDTLGLRSDPFFEAAHNPVQTFRSMIRVDPRRETGLIEVSIEGKDPEQI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAWVNEVARAYVERNLEVAQESVSFAVDQLTGQVKIMEQKLIEAEEARREAQSEAGISDLDGSLAIVRDRQSQYSKELTG
TAWVNEVARA                                                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEIELGKLDKSLTRLKELQDSGGDPMTLPELASDSELKELNRQRIRVERDIASADVSYRPGHPKYEEKVAELATVDRKIA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARIDEVVSGLRSEYGLKRDQERYLRGQLRSVQDRSEQLGEATSRLETKRIESETRKQVFDSMSKVTNQISLAAGLLTNNV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVLDEAIIPDTPIRPRKKVALMIGGLVGMFLGIGLVFFLDYLDNTFRTPKDIEQHLGLSVLSVIPKHSEKKLASGVIKEA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQSLRTSLIFSSKNRTRKVVLVTSSGPQEGKSTTISRLGRALATGGEKVVIIDCDLRRPTQQVHNEVPRSPGLTNFLAAP
                      TSSGPQEGKSTTISRLGRALATGGEKVVIIDCDLRRPTQQVHNEVPRSPGLTNFLAAP
                             GKS                 VIIDCDLR                       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESDKDWRPFAKETDTATLQIIPAGPTPPSPPDMLTSDRFLWLVNELQKEYDWVLIDSPPAAALSDAPLLATLAHMVVMVV
ESDKDWRPFAKETDTATLQIIPAGPTPPSPPDMLTSDRFLWLVNELQKEYDWVLIDSPPAAALSDAPLLATLAHMVVMVV
                                                    VLIDSPP                     
       650       660       670       680       690       700       710    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
RHNHTDRDVAIRAMTQVKNVNEHLIGAVLNNVDIDKSFSKDLYYTGYYYYSSDDGERKKKRKKSDKDLKVGAGA
RHNHTDRDVAIRAMTQVKNVNEHLIGAVLNNVDIDKSFSKDLYYTGYYYYSSDDGE                  
                                          YYTGYYYY                        

© 1998-2019