BYKdb

Annotate results for A0A192WXK4

A0A192WXK4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A192WXK4
DOMAINcd80/268TSAAPDEGKSFVSLNLSMAFGAENPSTLLIDADLRRPSIQRWITPTPTIGLTELMTDQVE
LDHVLFPMQNSQTTILPAGGTPSDPTALLSSSKFAKLVEELRNRFDWILIDTPPVVLFSD
ADAVSANCDGVLLVVRAGRTPKPMFKQAIGSLTSAPVVGTVINDVTFNLPDRQSHYSGYY
NWYYYEDRK
SITEWalker A87/89GKS
SITEWalker A'107/114LLIDADLR
SITEWalker B187/193ILIDTPP
SITEY Cluster255/264YSGYYNWYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSNAVIEPSTESEESMPEDHSEPLAAGGAPRGELVPRSIKETPDVVMLTQRSSVAAERFRRLKTRLVNESKNDERVLSIT
                                                                               T

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAAPDEGKSFVSLNLSMAFGAENPSTLLIDADLRRPSIQRWITPTPTIGLTELMTDQVELDHVLFPMQNSQTTILPAGGT
SAAPDEGKSFVSLNLSMAFGAENPSTLLIDADLRRPSIQRWITPTPTIGLTELMTDQVELDHVLFPMQNSQTTILPAGGT
      GKS                 LLIDADLR                                              
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSDPTALLSSSKFAKLVEELRNRFDWILIDTPPVVLFSDADAVSANCDGVLLVVRAGRTPKPMFKQAIGSLTSAPVVGTV
PSDPTALLSSSKFAKLVEELRNRFDWILIDTPPVVLFSDADAVSANCDGVLLVVRAGRTPKPMFKQAIGSLTSAPVVGTV
                          ILIDTPP                                               
       250       260         
....:....|....:....|....:....
INDVTFNLPDRQSHYSGYYNWYYYEDRKK
INDVTFNLPDRQSHYSGYYNWYYYEDRK 
              YSGYYNWYYY     
© 1998-2019