BYKdb

Annotate results for A0A193SC22

A0A193SC22 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A193SC22
DOMAINtad15/252EDIDLARIVGEFIDHRKLILSVTSICTMLAIVYALFATPIYQANSLLQIEQKQGNALLDS
LSQVLPNTQPQSAPEIALLQSRMILGKTVDDLNLQAEIEQQYFPIFGKGWARLMGNKPGK
IAISHIYLTKKNNNEAPEIEIKIIDNKNYLISGDDFQIKAKTGELIDSNGVTLLIDSIDA
EPDTKFQITYLSKLKAINNLLKNFSVADQGRDTGILNLTLTGDDPENIAKILDSISNN
DOMAINcd532/721SGASPSAGKSFVSSNLSAVVVQGGKRVLFIDCDMRKGYLHKVFNVSNDIGMSDILSGKNQ
FSSAVKHLEPEGFHFIPRGQVPPNPAELLMSKRCGEFLDWASKEYDLIVIDTPPILAVTD
AAILGRYVGTTLIVARFEANTAKEIDVSIKKFEQSGVQVKGCILNGVVKKASNYYGYGYS
SYGYSYKDDT
SITEWalker A539/541GKS
SITEWalker A'559/566LFIDCDMR
SITEWalker B639/645IVIDTPP
SITEY Cluster705/717YYGYGYSSYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSVISKKTNVTESEDIDLARIVGEFIDHRKLILSVTSICTMLAIVYALFATPIYQANSLLQIEQKQGNALLDSLSQVLP
              EDIDLARIVGEFIDHRKLILSVTSICTMLAIVYALFATPIYQANSLLQIEQKQGNALLDSLSQVLP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTQPQSAPEIALLQSRMILGKTVDDLNLQAEIEQQYFPIFGKGWARLMGNKPGKIAISHIYLTKKNNNEAPEIEIKIIDN
NTQPQSAPEIALLQSRMILGKTVDDLNLQAEIEQQYFPIFGKGWARLMGNKPGKIAISHIYLTKKNNNEAPEIEIKIIDN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNYLISGDDFQIKAKTGELIDSNGVTLLIDSIDAEPDTKFQITYLSKLKAINNLLKNFSVADQGRDTGILNLTLTGDDPE
KNYLISGDDFQIKAKTGELIDSNGVTLLIDSIDAEPDTKFQITYLSKLKAINNLLKNFSVADQGRDTGILNLTLTGDDPE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIAKILDSISNNYLTQNIERQAAQDAKSLEFLNVQLPKVRSDLDLAENKLNEYRRTKDTVDLSMEAKSVLDQIVNVDSQL
NIAKILDSISNN                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTFREAEISQLYTKAHPTYKALIEKRETLTQEKNRLNKRVSSMPTTQQEVLRLSRDVESGRAVYMMLLNRQQELNIAK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSAIGNVRIIDNAVTDPKPVRPGSILVVVIGFVIGLVFSSAIVILRIFLRRGIESPEQLEELGINVYASIPISEWMAKAN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INENKNKNKNNQKYSFLALDNPADLAIEAIRSLRTSLHFAMLEARNNILMISGASPSAGKSFVSSNLSAVVVQGGKRVLF
                                                   SGASPSAGKSFVSSNLSAVVVQGGKRVLF
                                                          GKS                 LF
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDCDMRKGYLHKVFNVSNDIGMSDILSGKNQFSSAVKHLEPEGFHFIPRGQVPPNPAELLMSKRCGEFLDWASKEYDLIV
IDCDMRKGYLHKVFNVSNDIGMSDILSGKNQFSSAVKHLEPEGFHFIPRGQVPPNPAELLMSKRCGEFLDWASKEYDLIV
IDCDMR                                                                        IV
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTPPILAVTDAAILGRYVGTTLIVARFEANTAKEIDVSIKKFEQSGVQVKGCILNGVVKKASNYYGYGYSSYGYSYKDD
IDTPPILAVTDAAILGRYVGTTLIVARFEANTAKEIDVSIKKFEQSGVQVKGCILNGVVKKASNYYGYGYSSYGYSYKDD
IDTPP                                                           YYGYGYSSYGYSY   
  
..
TK
T 

© 1998-2019