BYKdb

Annotate results for A0A193SCL9

A0A193SCL9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A193SCL9
DOMAINtad14/250DELDLGRVIGEIFDHRKLIIAVTSLFTLIALIYALLATPIYQADALIQVEQKQGNAILSS
LSQVFPDSQPQSAPEITLLQSRMILGKTVDDLNLQVKVEELFFPVIGQGLARLFNKTKNT
IQVHKLFISPNMYDDNFITLTVKNDHQYSISGENIDFDGEIGRLIDKNGIRIQVDSINAE
PGTRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLIKRVIDSISDN
DOMAINcd532/721SGASPNAGKTFVSSNLGGVIAQTGKKILFIDADLRKGYTHKIFNESNENGLSEYLSGKIK
LEDTIKHLGSEGFDFISRGMAPPNPAELLMHRRFGELIKWVSQAYDMVIIDTPPILAVTD
AAIIGNYVGTTLLVARFEQNTTKELEVSVKRFEQSGVAIKGCILNGVVKKASSYYGYGYA
HYGYSYKDEK
SITEWalker A539/541GKT
SITEWalker A'559/566LFIDADLR
SITEWalker B639/645VIIDTPP
SITEY Cluster705/717YYGYGYAHYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSIKSNKPINDSDELDLGRVIGEIFDHRKLIIAVTSLFTLIALIYALLATPIYQADALIQVEQKQGNAILSSLSQVFPD
             DELDLGRVIGEIFDHRKLIIAVTSLFTLIALIYALLATPIYQADALIQVEQKQGNAILSSLSQVFPD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQPQSAPEITLLQSRMILGKTVDDLNLQVKVEELFFPVIGQGLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQ
SQPQSAPEITLLQSRMILGKTVDDLNLQVKVEELFFPVIGQGLARLFNKTKNTIQVHKLFISPNMYDDNFITLTVKNDHQ

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YSISGENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLI
YSISGENIDFDGEIGRLIDKNGIRIQVDSINAEPGTRFLLTYTSRINAINYLRDSLLIADQGKDTGMLTISLLGSDPDLI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVIDSISDNYLEQNIARQAAQDAKSLDFLNQQLPKVRTELNESEDKLNAYRRQKDSVDLSLEAKSVLDQIVNVDNQLNE
KRVIDSISDN                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTFKESEISQLYTQEHPTYKALMEKRKILQDERAKLNKRVSTMPETQQEVLRLSRDVESGRAVYMQLLNRQQELNIAKSS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGNVRIIDNAVTQPKPVKPKKLIIIAIGLISGFAISLGVVFLRTFLRRGIESPEQLEDLGITVYASIPVAEVLSNRAKQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSKIRFKKEEDANYTYLATSHPTDLAIEAIRGLRTSLHFAMMEARNNILMISGASPNAGKTFVSSNLGGVIAQTGKKILF
                                                   SGASPNAGKTFVSSNLGGVIAQTGKKILF
                                                          GKT                 LF
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADLRKGYTHKIFNESNENGLSEYLSGKIKLEDTIKHLGSEGFDFISRGMAPPNPAELLMHRRFGELIKWVSQAYDMVI
IDADLRKGYTHKIFNESNENGLSEYLSGKIKLEDTIKHLGSEGFDFISRGMAPPNPAELLMHRRFGELIKWVSQAYDMVI
IDADLR                                                                        VI
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDTPPILAVTDAAIIGNYVGTTLLVARFEQNTTKELEVSVKRFEQSGVAIKGCILNGVVKKASSYYGYGYAHYGYSYKDE
IDTPPILAVTDAAIIGNYVGTTLLVARFEQNTTKELEVSVKRFEQSGVAIKGCILNGVVKKASSYYGYGYAHYGYSYKDE
IDTPP                                                           YYGYGYAHYGYSY   
 
.
K
K

© 1998-2019