BYKdb

Annotate results for A0A193SDN4

A0A193SDN4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A193SDN4
DOMAINtad16/252DTIQLGTIIGHLIDHKKLILSSMVMFALVGGLYSWIATPIYKADALIQVEQNTGNSILTN
LSSILPDNQPASAPEIELLKSRMVLGGAVEELNLDIEVKPKNFPIIGRLYNKFTGKQQPN
LPVISFNVPSENYNVEYIVKAVSNNEYELLLDGNKIFSGKVGERKEANGVVLYIADTTLT
QGNTYTLKKIAEVTAISNLLDQLNISEKGKDTGIISLSINGSDPVKIKNILSVISRI
DOMAINcd528/716SGPNPGIGKSFISTNLAVVIAQANMRVLLIDADLRRGELHKDFSIEMKNGLSDLLSNSVE
YDKAIIKNKIANLDFLPRGQVPPNPSELLMRKQFSNLLDWASNNYDLVIIDTPPVFAVTD
PVIIGKHAGTSFLVALFEGNTVKEIDAAKRRFENNGININGIILNGVVKRATNKYGNYAY
YQYSYESDK
SITEWalker A535/537GKS
SITEWalker A'555/562LLIDADLR
SITEWalker B635/641VIIDTPP
SITEY Cluster702/712YGNYAYYQYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MINDLNKNDRITNEEDTIQLGTIIGHLIDHKKLILSSMVMFALVGGLYSWIATPIYKADALIQVEQNTGNSILTNLSSIL
               DTIQLGTIIGHLIDHKKLILSSMVMFALVGGLYSWIATPIYKADALIQVEQNTGNSILTNLSSIL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PDNQPASAPEIELLKSRMVLGGAVEELNLDIEVKPKNFPIIGRLYNKFTGKQQPNLPVISFNVPSENYNVEYIVKAVSNN
PDNQPASAPEIELLKSRMVLGGAVEELNLDIEVKPKNFPIIGRLYNKFTGKQQPNLPVISFNVPSENYNVEYIVKAVSNN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYELLLDGNKIFSGKVGERKEANGVVLYIADTTLTQGNTYTLKKIAEVTAISNLLDQLNISEKGKDTGIISLSINGSDPV
EYELLLDGNKIFSGKVGERKEANGVVLYIADTTLTQGNTYTLKKIAEVTAISNLLDQLNISEKGKDTGIISLSINGSDPV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIKNILSVISRIYLSQNIERKSAEAAKSLDFLDKQLPEIRTALDESENKLNLYRQQKDSVDLSLEAKSVLDTVVQLDSQL
KIKNILSVISRI                                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NELTFREAEISKLYTKEHPSYKALLEKRRTLEDEKKRLSGKITALPQTQQEILKLTRDVQVNQEIYMQLLNKKQELSISK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASTVGNIRIIDPAITNPEPIAPQSVLIILMMTIFGAIVSIVYIIIHSILHKGIQSAEQLEEMGMNVYASVPLSELQFDKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKGGKLKAKRGILSEDSPADITVEAIRSLRTSLHFATMEARNNIIMISGPNPGIGKSFISTNLAVVIAQANMRVLLIDAD
                                               SGPNPGIGKSFISTNLAVVIAQANMRVLLIDAD
                                                      GKS                 LLIDAD
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRRGELHKDFSIEMKNGLSDLLSNSVEYDKAIIKNKIANLDFLPRGQVPPNPSELLMRKQFSNLLDWASNNYDLVIIDTP
LRRGELHKDFSIEMKNGLSDLLSNSVEYDKAIIKNKIANLDFLPRGQVPPNPSELLMRKQFSNLLDWASNNYDLVIIDTP
LR                                                                        VIIDTP
       650       660       670       680       690       700       710       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
PVFAVTDPVIIGKHAGTSFLVALFEGNTVKEIDAAKRRFENNGININGIILNGVVKRATNKYGNYAYYQYSYESDKR
PVFAVTDPVIIGKHAGTSFLVALFEGNTVKEIDAAKRRFENNGININGIILNGVVKRATNKYGNYAYYQYSYESDK 
P                                                            YGNYAYYQYSY     

© 1998-2019