BYKdb

Annotate results for A0A193SER6

A0A193SER6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A193SER6
DOMAINtad15/251EAIDFGRLIGELIDHRKLIIAITTGFTVLSVLYVLFATPIYQANALIQVEQKQGNAILSS
LTQILPDAQPQSAPEIALLQSRMILGKTVDNLNLQTQIENKYFPLIGRGIHRLTGDVGGK
IVIEKLYLPENGEKAPKIVLNVIDDNSYSIEGDGFTYKAKVGELIENKNVIIKVAKIDAK
PNEEFYVSYLSRLKAISNLQDAFNVTEQGKDTGMLSLTLTGDNPSLIKDILNNISEN
DOMAINcd529/718SGASPNAGKTFISTNLAATISSTDKKVLFIDADLRKGYVHKMLGGSQAYGLSDILSGQKE
ISQCVQKVENCTFDYIGRGPIPPNPAELLMHQRFEELLKWASRTYDLIIIDTPPILAVTD
AAIIGRYCGTALLVARFETNTAKEIAVSMKRFEQSGVHIKGCILNGVVKKASSYYGYGYS
HYGYSYTEKK
SITEWalker A536/538GKT
SITEWalker A'556/563LFIDADLR
SITEWalker B636/642IIIDTPP
SITEY Cluster702/714YYGYGYSHYGYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPETNNKPSATEAEAIDFGRLIGELIDHRKLIIAITTGFTVLSVLYVLFATPIYQANALIQVEQKQGNAILSSLTQILP
              EAIDFGRLIGELIDHRKLIIAITTGFTVLSVLYVLFATPIYQANALIQVEQKQGNAILSSLTQILP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQPQSAPEIALLQSRMILGKTVDNLNLQTQIENKYFPLIGRGIHRLTGDVGGKIVIEKLYLPENGEKAPKIVLNVIDDN
DAQPQSAPEIALLQSRMILGKTVDNLNLQTQIENKYFPLIGRGIHRLTGDVGGKIVIEKLYLPENGEKAPKIVLNVIDDN

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYSIEGDGFTYKAKVGELIENKNVIIKVAKIDAKPNEEFYVSYLSRLKAISNLQDAFNVTEQGKDTGMLSLTLTGDNPSL
SYSIEGDGFTYKAKVGELIENKNVIIKVAKIDAKPNEEFYVSYLSRLKAISNLQDAFNVTEQGKDTGMLSLTLTGDNPSL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKDILNNISENYLDQNVERQAAQDAKSLEFLNQQLPKVRNDLDIAEDKLNNYRKQRDSVDLTMEAKTVLDQIVNVDNQIN
IKDILNNISEN                                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELTFKEAEISQLYTKEHPTYKALMEKKQTLQTEKNKLNKKVSTMPSTQQEVLRLSRDVESGRAVYLQLLNRQQELNIAKS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIGNIRIIDNAITQPKPVEPKKILIVLIGLVVGMIFSILLVLLRVFLRRGIESPDQLEELGINVYASIPVSEWLAKQQA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNGRLKKNESDTLLAIENPADLAVEAIRSLRTSLHFAMMEAKNNVLMISGASPNAGKTFISTNLAATISSTDKKVLFIDA
                                                SGASPNAGKTFISTNLAATISSTDKKVLFIDA
                                                       GKT                 LFIDA
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKGYVHKMLGGSQAYGLSDILSGQKEISQCVQKVENCTFDYIGRGPIPPNPAELLMHQRFEELLKWASRTYDLIIIDT
DLRKGYVHKMLGGSQAYGLSDILSGQKEISQCVQKVENCTFDYIGRGPIPPNPAELLMHQRFEELLKWASRTYDLIIIDT
DLR                                                                        IIIDT
       650       660       670       680       690       700       710        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
PPILAVTDAAIIGRYCGTALLVARFETNTAKEIAVSMKRFEQSGVHIKGCILNGVVKKASSYYGYGYSHYGYSYTEKK
PPILAVTDAAIIGRYCGTALLVARFETNTAKEIAVSMKRFEQSGVHIKGCILNGVVKKASSYYGYGYSHYGYSYTEKK
PP                                                           YYGYGYSHYGYSY    

© 1998-2019