BYKdb

Annotate results for A0A193SFE2

A0A193SFE2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A193SFE2
DOMAINtad13/250DEIDIGRLYGELIDHRKLILSITAISVFISILYCLFATPVYQADALIQVEQKQGNTILES
LSQVLPDAQPQSAPEISLLQSRMILGKTVDDLKLQTIVTNNYFPIVGKGWARLIGENSGN
IDVENMIIPEQKLKENNKAILTVINNNEYTVSIDDTTYHGKVGVQIKEPNLSLLINKIDA
QPGDSFKIKYKTRLEAINDLANSFHVEDQGKDTGMLALTLTGDDPSLISVILNKISEN
DOMAINcd524/716SGASPNAGKTFVSSNLAVIEAQTGKSVLFIDADMRKGYSHKLFGINIGNDNVGLSELLSS
NYDFEKAINKIAEMKIDFISRGQVPHNPAEMLTSIKFDNLLRWAASNYDLVIVDTPPVLA
VTDAEIIGRYVGTTLLVARYETNTVKEMEVSIKRFERSGINVKGCILNGVMKKSSSYYGY
GYNHYGYTYNDDK
SITE-547/-549GKS
SITEWalker A'551/558LFIDADMR
SITEWalker B634/640VIVDTPP
SITEY Cluster700/712YYGYGYNHYGYTY
SITEWalker A531/533GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSSTKSNKRISADEIDIGRLYGELIDHRKLILSITAISVFISILYCLFATPVYQADALIQVEQKQGNTILESLSQVLPDA
            DEIDIGRLYGELIDHRKLILSITAISVFISILYCLFATPVYQADALIQVEQKQGNTILESLSQVLPDA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPQSAPEISLLQSRMILGKTVDDLKLQTIVTNNYFPIVGKGWARLIGENSGNIDVENMIIPEQKLKENNKAILTVINNNE
QPQSAPEISLLQSRMILGKTVDDLKLQTIVTNNYFPIVGKGWARLIGENSGNIDVENMIIPEQKLKENNKAILTVINNNE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTVSIDDTTYHGKVGVQIKEPNLSLLINKIDAQPGDSFKIKYKTRLEAINDLANSFHVEDQGKDTGMLALTLTGDDPSLI
YTVSIDDTTYHGKVGVQIKEPNLSLLINKIDAQPGDSFKIKYKTRLEAINDLANSFHVEDQGKDTGMLALTLTGDDPSLI

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVILNKISENYLEQNVSRQAAQDARSLEFLNERLPKVRDDLDRAEDKLNSYRKQKDSVDLSLEAKATLDQLVNVDNQINE
SVILNKISEN                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTFREAEISQLFTKDHPTYKALIEKKNTLSKERGLLNNRISAMPATQQEVLRLSRDVESGRTVYMMLLNRQQELEISKSS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIGNVRIVDESVTEPEPVKPKKAMVVILGVLLGGLISVGVVLLRVSFRRGIESPEQLEEVGISVYSSIPVSEWLESNNKT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RHGDSRNLLAIDNPADLAIEAIRGLRTSLHFAMLEAKNNILMISGASPNAGKTFVSSNLAVIEAQTGKSVLFIDADMRKG
                                           SGASPNAGKTFVSSNLAVIEAQTGKSVLFIDADMRKG
                                                  GKT                 LFIDADMR  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YSHKLFGINIGNDNVGLSELLSSNYDFEKAINKIAEMKIDFISRGQVPHNPAEMLTSIKFDNLLRWAASNYDLVIVDTPP
YSHKLFGINIGNDNVGLSELLSSNYDFEKAINKIAEMKIDFISRGQVPHNPAEMLTSIKFDNLLRWAASNYDLVIVDTPP
                                                                         VIVDTPP
       650       660       670       680       690       700       710      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
VLAVTDAEIIGRYVGTTLLVARYETNTVKEMEVSIKRFERSGINVKGCILNGVMKKSSSYYGYGYNHYGYTYNDDK
VLAVTDAEIIGRYVGTTLLVARYETNTVKEMEVSIKRFERSGINVKGCILNGVMKKSSSYYGYGYNHYGYTYNDDK
                                                           YYGYGYNHYGYTY    

© 1998-2019