BYKdb

Annotate results for A0A196MLP0

A0A196MLP0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A196MLP0
DOMAINtad21/188LASAARTYWTVLRRHRVILFVTMALCLLAALLYILLSTPDYRATASVEVEDVPAGAAGAG
AARSMTDDTETVMQTELEVLRSRALAEEVVRDLALVGTPTFFEGMGVSPPKEGSAGLSQR
QVEQERVVALLRRNLEVELPGKSRIIRISFVSADPVLSARVANSYADS
DOMAINcd531/710TSAQEGEGKSLTLNALARALAGLGKTVLVIDGDMRRPVQHALFRVAPGKGISEVLTGQAR
AADAIIPTGVERLALLPCGAVPPNPAELLATPALDDLLAAVRDDYDTILIDAPPILGLGD
TPLLGARVQASLMVVEWGRNHHGGLRVSVDRLRRAGGVIIGAILTKQQGRAFEYDYHRGG
SITE-554/-556GKT
SITEWalker A'558/565LVIDGDMR
SITEWalker B638/644ILIDAPP
SITEY Cluster704/706YDY
SITEWalker A538/540GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVATRIDPVDSPEVEGIGARLASAARTYWTVLRRHRVILFVTMALCLLAALLYILLSTPDYRATASVEVEDVPAGAAGAG
                    LASAARTYWTVLRRHRVILFVTMALCLLAALLYILLSTPDYRATASVEVEDVPAGAAGAG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AARSMTDDTETVMQTELEVLRSRALAEEVVRDLALVGTPTFFEGMGVSPPKEGSAGLSQRQVEQERVVALLRRNLEVELP
AARSMTDDTETVMQTELEVLRSRALAEEVVRDLALVGTPTFFEGMGVSPPKEGSAGLSQRQVEQERVVALLRRNLEVELP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSRIIRISFVSADPVLSARVANSYADSLIRSDLKRGFESGVQARRFLLGELDGARRDLSRAERELAIYAARTGGAPVEP
GKSRIIRISFVSADPVLSARVANSYADS                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKGAQEAGKPRSPEPKFAPSEGSIETRLAQLNGYRAQAVSERIAAQKRWESARRASVETLPEVLNNGAMQQLMAERAQAR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AALVEERQFRKDAHPEMREARARLAALDDQATEMANRIRASLKEQYDVAVHGEKQIATEIAGLERDAQAARGRDVQLSIY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERSVDTYRMLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPAHPFSPKIGETLLLAALGGLALGLLLVAARHIFDDAVTS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADTLAERVGLPLLGAVPVTGDNPQPPEIFTPIARSLLLASAGGLPRSILVTSAQEGEGKSLTLNALARALAGLGKTVLVI
                                                  TSAQEGEGKSLTLNALARALAGLGKTVLVI
                                                         GKS                 LVI
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDMRRPVQHALFRVAPGKGISEVLTGQARAADAIIPTGVERLALLPCGAVPPNPAELLATPALDDLLAAVRDDYDTILI
DGDMRRPVQHALFRVAPGKGISEVLTGQARAADAIIPTGVERLALLPCGAVPPNPAELLATPALDDLLAAVRDDYDTILI
DGDMR                                                                        ILI
       650       660       670       680       690       700       710
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAPPILGLGDTPLLGARVQASLMVVEWGRNHHGGLRVSVDRLRRAGGVIIGAILTKQQGRAFEYDYHRGG
DAPPILGLGDTPLLGARVQASLMVVEWGRNHHGGLRVSVDRLRRAGGVIIGAILTKQQGRAFEYDYHRGG
DAPP                                                           YDY    

© 1998-2019