BYKdb

Annotate results for A0A197BRP3

A0A197BRP3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A197BRP3
DOMAINtad24/193FAAAASGAWTAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDVPAGAAGAA
AAQRQATPSDNEALMQTELEVLRSRALAEDVARELALIGSRTFFDGMNVRRPEQGTGALS
QRQVETETVVGLLRDNLHVELPGKSRVIRISFTSADPVLSARVANSYADS
DOMAINcd534/713TSAQEGEGKSSTLHALARALAKLDKRVLVIDADMRRPKQHSLFGISPARGISELMTGQAR
MDDVIVDSGVPGVALLPCGAIPPNPAELLVTPAMDSLLATVRERYDTVLIDAPPILGLSD
ACLLASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRAFEYDYHRGG
SITEWalker A541/543GKS
SITEWalker A'561/568LVIDADMR
SITEWalker B641/647VLIDAPP
SITEY Cluster707/709YDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARPGLLIDDSGASTSMEGRAARFAAAASGAWTAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDVPAGAA
                       FAAAASGAWTAVRRHRIILFVTMALCVLAGVVFILLSTPDYRATASVEVEDVPAGAA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAAAAQRQATPSDNEALMQTELEVLRSRALAEDVARELALIGSRTFFDGMNVRRPEQGTGALSQRQVETETVVGLLRDNL
GAAAAQRQATPSDNEALMQTELEVLRSRALAEDVARELALIGSRTFFDGMNVRRPEQGTGALSQRQVETETVVGLLRDNL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HVELPGKSRVIRISFTSADPVLSARVANSYADSLIRADLKRGFESGVQARRFLLGELDGARKDLERAERDLAVYAANAGA
HVELPGKSRVIRISFTSADPVLSARVANSYADS                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALPGSREAGSKEAGSKEDDGDPSPEVTIATRLAQLNAFRAQATADRIAAQKRWESARMSSVETLPEVLNNGAMQQIMTE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAQARAQVVQERQFRKDAHPEMREARARLAALDDQAEGMANTIRASLKEQFDVAVHGEKQIQSEIAKVERQARAERGRGV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QMSILERQVDTYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPSRPSSPNIGVTMLFASLGGLILGLMAVAGRHIFD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAVTSADTLVERVNLPLLGAVPAGEKPGAEIFAPMASSLLLGSAAGLPRSILVTSAQEGEGKSSTLHALARALAKLDKRV
                                                     TSAQEGEGKSSTLHALARALAKLDKRV
                                                            GKS                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVIDADMRRPKQHSLFGISPARGISELMTGQARMDDVIVDSGVPGVALLPCGAIPPNPAELLVTPAMDSLLATVRERYDT
LVIDADMRRPKQHSLFGISPARGISELMTGQARMDDVIVDSGVPGVALLPCGAIPPNPAELLVTPAMDSLLATVRERYDT
LVIDADMR                                                                        
       650       660       670       680       690       700       710   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VLIDAPPILGLSDACLLASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRAFEYDYHRGG
VLIDAPPILGLSDACLLASKAQVTLLVVEWGRNHHGGLRVAVDRLRRAGGAIIGAILTKQEGRAFEYDYHRGG
VLIDAPP                                                           YDY    

© 1998-2019