BYKdb

Annotate results for A0A198A864

A0A198A864 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A198A864
DOMAINcd49/230TSAQPGDGKSTTAANLSVAYAQEGKKVLIVDADLRKPTLHHYFGKSNRYGLTSAIVNRNQ
FDEFICETSIENLFLIPSGPIPPNPSELLMSQKMTVFLEEMAARFDVIIIDSPPTLAVAD
AQILATKCDGVVMVIRDGKVKRDMARKAIHNLQRVQAKVLGVVLNNKRPKKSDGAYYDYY
GD
SITE-92/-94GKS
SITEWalker A'76/83LIVDADLR
SITEWalker B156/162IIIDSPP
SITEY Cluster224/228YYDYY
SITEWalker A56/58GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRSMRTLINKHPLITESHPKSQVSESYRTLRTNIQFSSIDRSMKTLLVTSAQPGDGKSTTAANLSVAYAQEGKKVLIVDA
                                                TSAQPGDGKSTTAANLSVAYAQEGKKVLIVDA
                                                       GKS                 LIVDA
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPTLHHYFGKSNRYGLTSAIVNRNQFDEFICETSIENLFLIPSGPIPPNPSELLMSQKMTVFLEEMAARFDVIIIDS
DLRKPTLHHYFGKSNRYGLTSAIVNRNQFDEFICETSIENLFLIPSGPIPPNPSELLMSQKMTVFLEEMAARFDVIIIDS
DLR                                                                        IIIDS
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPTLAVADAQILATKCDGVVMVIRDGKVKRDMARKAIHNLQRVQAKVLGVVLNNKRPKKSDGAYYDYYGD
PPTLAVADAQILATKCDGVVMVIRDGKVKRDMARKAIHNLQRVQAKVLGVVLNNKRPKKSDGAYYDYYGD
PP                                                             YYDYY  
© 1998-2019