BYKdb

Annotate results for A0A199QE22

A0A199QE22 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A199QE22
DOMAINcd52/235TSAIQGEGKSTVGSNLAVEYAKKGLQVLLVDADLRRPTIHQTFAISNQRGVSSWLSGQLT
DVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVIVDAPPILPVTD
ARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYG
TETN
SITEWalker A59/61GKS
SITEWalker A'79/86LLVDADLR
SITEWalker B159/165VIVDAPP
SITEY Cluster225/230YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLRRRVANMHTGIQLTTLTAPMSVVTEQVKTIRTNLNYAMVGKPLKTLMITSAIQGEGKSTVGSNLAVEYAKKGLQVLL
                                                   TSAIQGEGKSTVGSNLAVEYAKKGLQVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDADLRRPTIHQTFAISNQRGVSSWLSGQLTDVNEAIYPVLDHLFVMPSGPKPPNPAELLASDRMTEFLTVATRKLDLVI
VDADLR                                                                        VI
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
VDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSALKNARAQLLGTILNDVDIKTHGYGYGYYGTETN
VDAPP                                                           YGYGYY     
© 1998-2019