BYKdb

Annotate results for A0A1A0XID5

A0A1A0XID5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A0XID5
DOMAINtad7/143ALRRVSNSLSLVVRAWWIVAMCALVAGTSAFLYSLNETPVYRSTATLYVTAGTDANTAAA
YQGSLASQQRIGSYAQLVLSDSVLSAAIRDSGSSKSVSELRAMAEVKTTPETVLLKVSVY
DPDSAEAAMLANSISAA
DOMAINcd275/457TSPRPGDGKTTTAISMAIASAEDGKKTLLVDADLRRPTIDERFGLAGSVGLSTVLSANLD
WRDAIQDTEWQSLSVLCSGEVPPNPAELLGSARAVSLFEALKEEYERIIIDSPPVLPVTD
SAVLAALADGVVLVVRSGTTKTTDTVSAVEQLERADAGVFGVVLNYAEASNGVYSYLYEY
SRP
SITEWalker A282/284GKT
SITEWalker A'302/309LLVDADLR
SITEWalker B382/388IIIDSPP
SITEY Cluster448/454YSYLYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTSRNLALRRVSNSLSLVVRAWWIVAMCALVAGTSAFLYSLNETPVYRSTATLYVTAGTDANTAAAYQGSLASQQRIGSY
      ALRRVSNSLSLVVRAWWIVAMCALVAGTSAFLYSLNETPVYRSTATLYVTAGTDANTAAAYQGSLASQQRIGSY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQLVLSDSVLSAAIRDSGSSKSVSELRAMAEVKTTPETVLLKVSVYDPDSAEAAMLANSISAALLSSIDSLERPPGASEA
AQLVLSDSVLSAAIRDSGSSKSVSELRAMAEVKTTPETVLLKVSVYDPDSAEAAMLANSISAA                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAKATVVSPAVATSVPVSPNRKRYVVFGIIIGALVGILIVVIRSRFDNKVRTPDDVKDMELSVLSVIPADEALASRRFGP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYSFGATAAAEAYRKLRTNLSFVVVDTPSHCLVVTSPRPGDGKTTTAISMAIASAEDGKKTLLVDADLRRPTIDERFGLA
                                  TSPRPGDGKTTTAISMAIASAEDGKKTLLVDADLRRPTIDERFGLA
                                         GKT                 LLVDADLR           
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GSVGLSTVLSANLDWRDAIQDTEWQSLSVLCSGEVPPNPAELLGSARAVSLFEALKEEYERIIIDSPPVLPVTDSAVLAA
GSVGLSTVLSANLDWRDAIQDTEWQSLSVLCSGEVPPNPAELLGSARAVSLFEALKEEYERIIIDSPPVLPVTDSAVLAA
                                                             IIIDSPP            
       410       420       430       440       450       
....:....|....:....|....:....|....:....|....:....|....:..
LADGVVLVVRSGTTKTTDTVSAVEQLERADAGVFGVVLNYAEASNGVYSYLYEYSRP
LADGVVLVVRSGTTKTTDTVSAVEQLERADAGVFGVVLNYAEASNGVYSYLYEYSRP
                                               YSYLYEY   
© 1998-2019