BYKdb

Annotate results for A0A1A1YNQ5

A0A1A1YNQ5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A1YNQ5
DOMAINtad1/136MTIQELLRAMRARWLIIVATAAVAVAATVFYNILTTPLYESSTRLFVSTSAAPGDASQIY
SGTLSSQQRVVSYTKLLTGETLAQRVVDKLHLDMTAEALRKEVKATAPPDTVLIDVSVLD
ASPVRARDIADALSDE
DOMAINcd268/456TSSLPDEGKSTIAINIALALAEADYNVVVIDGDMRRPKLAEYLDVIGSVGLSTVLAGRAS
LPEVLQKTRFPGLTALTSGAVPPNPSELLGSEAAKKVLRELRGGFDYVIVDSSPLLAVTD
SAILAAESDGVLVIAKFATTKREQLAQAIENLTKVGARILGGIFAMSPTGKTGNYHYPYY
GKEQKPAAG
SITE-437/-439GKT
SITEWalker A'295/302VVIDGDMR
SITEWalker B375/381VIVDSSP
SITEY Cluster442/447YHYPYY
SITEWalker A275/277GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIQELLRAMRARWLIIVATAAVAVAATVFYNILTTPLYESSTRLFVSTSAAPGDASQIYSGTLSSQQRVVSYTKLLTGE
MTIQELLRAMRARWLIIVATAAVAVAATVFYNILTTPLYESSTRLFVSTSAAPGDASQIYSGTLSSQQRVVSYTKLLTGE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLAQRVVDKLHLDMTAEALRKEVKATAPPDTVLIDVSVLDASPVRARDIADALSDEFVVMVRELETPPDGEAPVARVVVE
TLAQRVVDKLHLDMTAEALRKEVKATAPPDTVLIDVSVLDASPVRARDIADALSDE                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHASVAAKPVIPETTRNIAIGLALGVLLGIALAILRDRLDNTVKSRQVFEEIAGAGLIANIPFDKDRRKDPGISFANDVS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIAEAFRELRTNLQFLEVDDPPRVLVVTSSLPDEGKSTIAINIALALAEADYNVVVIDGDMRRPKLAEYLDVIGSVGLST
                           TSSLPDEGKSTIAINIALALAEADYNVVVIDGDMRRPKLAEYLDVIGSVGLST
                                  GKS                 VVIDGDMR                  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLAGRASLPEVLQKTRFPGLTALTSGAVPPNPSELLGSEAAKKVLRELRGGFDYVIVDSSPLLAVTDSAILAAESDGVLV
VLAGRASLPEVLQKTRFPGLTALTSGAVPPNPSELLGSEAAKKVLRELRGGFDYVIVDSSPLLAVTDSAILAAESDGVLV
                                                      VIVDSSP                   
       410       420       430       440       450       460       470     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
IAKFATTKREQLAQAIENLTKVGARILGGIFAMSPTGKTGNYHYPYYGKEQKPAAGAHPAFRHGADDRLRHRRKQ
IAKFATTKREQLAQAIENLTKVGARILGGIFAMSPTGKTGNYHYPYYGKEQKPAAG                   
                                         YHYPYY                            
© 1998-2019