BYKdb

Annotate results for A0A1A5K2J9

A0A1A5K2J9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A5K2J9
DOMAINtad24/219DFIDVERLLGMAARQAKVVAVCAVIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIVDDI
SAASTTMQTDSAILSQIEILTSTRLAAVVVDKLKLDQNDAFMNPPQSALAQGVGLIRGLI
QYVHPSSPMPGMGDISKLDPATRDALIAASRRDYAILKLQNEIRADRVGRSYVIALGYQA
TDPGLAKAITKAYADA
DOMAINcd590/781ISVLPGEGKSTVAANLAGLLASNGARTLLIDGDLRNPGLSRSLGMEAEQGLMEAVVNGQT
WQSVGKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPV
VDAKAFAPLVDGFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSF
GASEKFFDKYSS
SITEWalker A597/599GKS
SITEWalker A'617/624LLIDGDLR
SITEWalker B699/705IVVDLPP
SITEY Cluster779/783YSSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNYANFPLDKRMPLPNSDAGNGEDFIDVERLLGMAARQAKVVAVCAVIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIV
                       DFIDVERLLGMAARQAKVVAVCAVIGLFLGMLYLQTTPPKYVSVSSVLIDEGLNKIV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDISAASTTMQTDSAILSQIEILTSTRLAAVVVDKLKLDQNDAFMNPPQSALAQGVGLIRGLIQYVHPSSPMPGMGDISK
DDISAASTTMQTDSAILSQIEILTSTRLAAVVVDKLKLDQNDAFMNPPQSALAQGVGLIRGLIQYVHPSSPMPGMGDISK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDPATRDALIAASRRDYAILKLQNEIRADRVGRSYVIALGYQATDPGLAKAITKAYADAYLADQLDASFDATERAAVWLQ
LDPATRDALIAASRRDYAILKLQNEIRADRVGRSYVIALGYQATDPGLAKAITKAYADA                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRLTELRESSQQASLAVEKFRAEHGLSANSDGQLMSDKQLADLNAQLIVAQADTARASARYQQYKSIVDSGSDNAFNDAA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISSDQPSSSVISSLKTRYLAVAKRQQDVEANFGPQHPQAVALAKEKADISAQIFGELKQLTESYRNEYEVALARETALRA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVAAAQGKSSIDNQSQVQLRDLDQKATALTTLYQTFLGRYEEAAQQRSFPVGKIRIISDASTPLSASSPRTVIVLGLSLV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGVLMGAGFGGLNEFNERFFRTGEEVRDRVGLKFLGYLPSIGSRPAKDDKPAEAQPDVKAARSPAALERRARMRVSIDAP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASMFSETLRSAKIAFDVVMEGQGSRVVGVISVLPGEGKSTVAANLAGLLASNGARTLLIDGDLRNPGLSRSLGMEAEQGL
                             ISVLPGEGKSTVAANLAGLLASNGARTLLIDGDLRNPGLSRSLGMEAEQGL
                                    GKS                 LLIDGDLR                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEAVVNGQTWQSVGKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVD
MEAVVNGQTWQSVGKIDRQTKLAIIPAVLRGNFSHTSELLSSAGMRRFIENAKETFEYIVVDLPPLGPVVDAKAFAPLVD
                                                          IVVDLPP               
       730       740       750       760       770       780       790     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
GFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGASEKFFDKYSSYYLDKSEVRSKATV
GFVLVTEWGRTPRAMVRSMLESEPYVANKIVGAVLNKVDLKKLAKYGSFGASEKFFDKYSS              
                                                          YSSYY            

© 1998-2019