BYKdb

Annotate results for A0A1A5VE64

A0A1A5VE64 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A5VE64
DOMAINcd56/244TSSAPSEGKSTVSNNVAVTWADQGKSVLIVDADMRRPTVHRTFRTSNAVGLSNLLAGTGS
LDDAIHSTVVENLSVMPSGPIPPNPSELLGSSKMVNLLGVLTTKFDLVIIDAPPVNTVTD
AQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYY
GGYYGGYYG
SITE-79/-81GKS
SITEWalker A'83/90LIVDADMR
SITEWalker B163/169VIIDAPP
SITEY Cluster230/243YYGGYYGGYYGGYY
SITEWalker A63/65GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFFKKKPKLDNESLKNGVGLITYNDPTSTIAEQFRTVRTNIQFSSVDKQLKSIVFTSSAPSEGKSTVSNNVAVTWADQGK
                                                       TSSAPSEGKSTVSNNVAVTWADQGK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVLIVDADMRRPTVHRTFRTSNAVGLSNLLAGTGSLDDAIHSTVVENLSVMPSGPIPPNPSELLGSSKMVNLLGVLTTKF
SVLIVDADMRRPTVHRTFRTSNAVGLSNLLAGTGSLDDAIHSTVVENLSVMPSGPIPPNPSELLGSSKMVNLLGVLTTKF
  LIVDADMR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYYGGYYG
DLVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQMLETVQANILGAILNRASAEKSTGYYGGYYGGYYG
  VIIDAPP                                                            YYGGYYGGYYG
        
....:...
GYYGTDDK
GYYG    
GYY     
© 1998-2019