BYKdb

Annotate results for A0A1A5X1V0

A0A1A5X1V0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A5X1V0
DOMAINtad15/276EERYLGDYLQTIVANWRTIVVVTLAVTLLGAAYAFLATPTYRADVMFHLVDKTDSSKKDP
GLPPINGMFDEKTSANGEIEMLKSRLVTQETVNRLHLDIAARPREMPVLGGMLAGLENGS
WGIRLPSFLRSNNYAWGRGAIAVSRFDTPDALYDQDFTLIAGEDGAYVLRDAEGAALLQG
RVGEDVTANTADGPISLHVDSLSGPAGTPFTLTRASTLTTVERLQRALDVSEVGLQSGVI
RASLEGHNSKLTADILNNMARE
DOMAINcd553/741TGSRPDIGKSFLSVNLAALVASVNKRVLIVDGDMRRGDVHSHFGIAHQPGLSDVLLGADL
NAAIQREVLPGLDVLAKGSLHAHPSELLMSARFERLLEELKSKYDLVIVDTPPVLAVTDS
TVIGRYAGTTLLAIRHGRHPLSELEETAKRLRNGGVNLCGVLLTDVPQTGAFVGGGYRGG
YYGYESIAG
SITEWalker A560/562GKS
SITEWalker A'580/587LIVDGDMR
SITEWalker B659/665VIVDTPP
SITEY Cluster729/736YRGGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAMNYVDGGYAVSTEERYLGDYLQTIVANWRTIVVVTLAVTLLGAAYAFLATPTYRADVMFHLVDKTDSSKKDPGLPPIN
              EERYLGDYLQTIVANWRTIVVVTLAVTLLGAAYAFLATPTYRADVMFHLVDKTDSSKKDPGLPPIN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GMFDEKTSANGEIEMLKSRLVTQETVNRLHLDIAARPREMPVLGGMLAGLENGSWGIRLPSFLRSNNYAWGRGAIAVSRF
GMFDEKTSANGEIEMLKSRLVTQETVNRLHLDIAARPREMPVLGGMLAGLENGSWGIRLPSFLRSNNYAWGRGAIAVSRF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPDALYDQDFTLIAGEDGAYVLRDAEGAALLQGRVGEDVTANTADGPISLHVDSLSGPAGTPFTLTRASTLTTVERLQR
DTPDALYDQDFTLIAGEDGAYVLRDAEGAALLQGRVGEDVTANTADGPISLHVDSLSGPAGTPFTLTRASTLTTVERLQR

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALDVSEVGLQSGVIRASLEGHNSKLTADILNNMAREFIRQDVQSRSAEAEHMLAFLDEQLPQLRKQLDDAEQKYNNFRNQ
ALDVSEVGLQSGVIRASLEGHNSKLTADILNNMARE                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HGTVDLGEESRLLLQQVVDNKTRLEDLQQQRAELAQRFTEHHPAVAALDAQIAALASSQATLQGKVKSLPDTEQAAVRLL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDVHVNTELYTNLLNSAQQLRVAKAGQVGDVRVVDFAEAPDDPVRPKRLLVIVLSIGAGIVLGILIAFMRKSLYGGVERP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DELEAALGVPVFAVVPRSHKQLRLQHHVATRRRGLHVLAQQSPQDIAVEGVRSLRTTLQLSLNEASNNIVMLTGSRPDIG
                                                                        TGSRPDIG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSFLSVNLAALVASVNKRVLIVDGDMRRGDVHSHFGIAHQPGLSDVLLGADLNAAIQREVLPGLDVLAKGSLHAHPSELL
KSFLSVNLAALVASVNKRVLIVDGDMRRGDVHSHFGIAHQPGLSDVLLGADLNAAIQREVLPGLDVLAKGSLHAHPSELL
KS                 LIVDGDMR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSARFERLLEELKSKYDLVIVDTPPVLAVTDSTVIGRYAGTTLLAIRHGRHPLSELEETAKRLRNGGVNLCGVLLTDVPQ
MSARFERLLEELKSKYDLVIVDTPPVLAVTDSTVIGRYAGTTLLAIRHGRHPLSELEETAKRLRNGGVNLCGVLLTDVPQ
                  VIVDTPP                                                       
       730       740 
....:....|....:....|.
TGAFVGGGYRGGYYGYESIAG
TGAFVGGGYRGGYYGYESIAG
        YRGGYYGY     

© 1998-2019