BYKdb

Annotate results for A0A1A5XLR9

A0A1A5XLR9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1A5XLR9
DOMAINtad22/285DDVSLLMLWQNVLSHRRLFYGITAGVVALAVLYLLVAAPVYKADALIQVDEQQGSALGAL
SDVASALSLNKPIDGELDILTSRAVLEPAIDATQARTTVKVANRVPLLGRLYGRYYTPPD
GIADAPLGLTGFAWGGERLVLSAFDAPRVLYGKKFRVRAQGGGRWTLEDRDGNLLARGAL
NQRVAFEAPTDFGPAPGFIEIRELHGRPGASFTLVESSLDDTIDVMRKRMTVQETTKGSS
MIALSVKNSEPGLAAAFANAVARA
DOMAINcd567/752TGPTEGVGKTFVALNFAYVLALKGLRVLIVDADLRRAGARRYFSANTSYKGLANVLAGDA
QLEDALVQTGFDGLDLLPAGSALPPNPGELLERPAFAAMLKEAATRYDYVIVDSPPVLPV
SDAVTLAQVCDATFVVSRADTTSRHQLAETMKRLNQSGIRVTGQVFNGFRATRYGYGYGY
RYQAQG
SITEWalker A574/576GKT
SITEWalker A'594/601LIVDADLR
SITEWalker B676/682VIVDSPP
SITE-673/-675YDY
SITEY Cluster740/748YGYGYGYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKSESTLPTMLANAAAQDRSDDDVSLLMLWQNVLSHRRLFYGITAGVVALAVLYLLVAAPVYKADALIQVDEQQGSALGA
                     DDVSLLMLWQNVLSHRRLFYGITAGVVALAVLYLLVAAPVYKADALIQVDEQQGSALGA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSDVASALSLNKPIDGELDILTSRAVLEPAIDATQARTTVKVANRVPLLGRLYGRYYTPPDGIADAPLGLTGFAWGGERL
LSDVASALSLNKPIDGELDILTSRAVLEPAIDATQARTTVKVANRVPLLGRLYGRYYTPPDGIADAPLGLTGFAWGGERL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLSAFDAPRVLYGKKFRVRAQGGGRWTLEDRDGNLLARGALNQRVAFEAPTDFGPAPGFIEIRELHGRPGASFTLVESSL
VLSAFDAPRVLYGKKFRVRAQGGGRWTLEDRDGNLLARGALNQRVAFEAPTDFGPAPGFIEIRELHGRPGASFTLVESSL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDTIDVMRKRMTVQETTKGSSMIALSVKNSEPGLAAAFANAVARAYVALNIKHRAEQSRLSLEFLNRKLPAFREELAQSE
DDTIDVMRKRMTVQETTKGSSMIALSVKNSEPGLAAAFANAVARA                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRLNAYRIRTKTIDIEEQTEALLTRAVDLTKQKTLIDLNLQATREQFRPGHPAVKTLEAQDSVLDGALRDVEKQVQALPS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQQDYLRLARDVAVDTQLYTALVANAQQLEVAEAGTTGNVSVIDFAARPDSAAWPKTPIVLAGGVFGGVFLAFLVVQALA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALRDTLRDPLDVERVGQAPIFAVVPASTAESQAARGQRRGNKRQSAQPVALLASSSPGDPSVEALRSLRTTLRFSLLGKE


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGSILFTGPTEGVGKTFVALNFAYVLALKGLRVLIVDADLRRAGARRYFSANTSYKGLANVLAGDAQLEDALVQTGFDGL
      TGPTEGVGKTFVALNFAYVLALKGLRVLIVDADLRRAGARRYFSANTSYKGLANVLAGDAQLEDALVQTGFDGL
             GKT                 LIVDADLR                                       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLPAGSALPPNPGELLERPAFAAMLKEAATRYDYVIVDSPPVLPVSDAVTLAQVCDATFVVSRADTTSRHQLAETMKRL
DLLPAGSALPPNPGELLERPAFAAMLKEAATRYDYVIVDSPPVLPVSDAVTLAQVCDATFVVSRADTTSRHQLAETMKRL
                                   VIVDSPP                                      
       730       740       750  
....:....|....:....|....:....|..
NQSGIRVTGQVFNGFRATRYGYGYGYRYQAQG
NQSGIRVTGQVFNGFRATRYGYGYGYRYQAQG
                   YGYGYGYRY    

© 1998-2019