BYKdb

Annotate results for A0A1A6AIM3

A0A1A6AIM3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A6AIM3
DOMAINcd42/230TSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRLHKIFLTSNEIGLSDVLAGKVE
FEDAVKETGVENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVTD
AQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYH
YYYGSDGTK
SITEWalker A49/51GKS
SITEWalker A'69/76IIIDCDQR
SITEWalker B149/155IIIDTPP
SITE-146/-148YEY
SITEY Cluster215/224YYGYYYHYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKPDIITVKNPKDPIAEAYRTLRTNIQFSSFDKKIQTIMLTSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRL
                                         TSSGPGEGKSTTCSNLAVVMAESGSKTIIIDCDQRKPRL
                                                GKS                 IIIDCDQR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKIFLTSNEIGLSDVLAGKVEFEDAVKETGVENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVT
HKIFLTSNEIGLSDVLAGKVEFEDAVKETGVENLNLLTSGTRPPNPSELLGSKKMENFLQDLKEKYEYIIIDTPPVVAVT
                                                                    IIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYHYYYGSDGTKIKKKKKKTKK
DAQLLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANVIGVVLNKLEIKEKGYYGYYYHYYYGSDGTK          
                                                      YYGYYYHYYY                
© 1998-2019