BYKdb

Annotate results for A0A1A7LXF3

A0A1A7LXF3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A7LXF3
DOMAINcd53/235TSSTPGEGKSTNAANLGVVFAQEDKRVLIIDADMRKPTLHHTFKTFNKVGLSNILARRSA
LHDAVQETFIVGLDVITSGPIPPNPAELLSSQGLDALLQHVKNDYDIIILDSPPLLSVTD
AQILANKCDGTIMILNTGVVDKRAVKKAKALLSASHTKILGVVLNNYKTPNHFNYYNGYH
YAE
SITEWalker A60/62GKS
SITEWalker A'80/87LIIDADMR
SITEWalker B160/166IILDSPP
SITEY Cluster227/233YYNGYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKKKNGLKDSQIARKLVTFTETKSHIIEQFRTIRTNIKFSMPDEPLKTILITSSTPGEGKSTNAANLGVVFAQEDKRVL
                                                    TSSTPGEGKSTNAANLGVVFAQEDKRVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDADMRKPTLHHTFKTFNKVGLSNILARRSALHDAVQETFIVGLDVITSGPIPPNPAELLSSQGLDALLQHVKNDYDII
IIDADMRKPTLHHTFKTFNKVGLSNILARRSALHDAVQETFIVGLDVITSGPIPPNPAELLSSQGLDALLQHVKNDYDII
IIDADMR                                                                        I
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
ILDSPPLLSVTDAQILANKCDGTIMILNTGVVDKRAVKKAKALLSASHTKILGVVLNNYKTPNHFNYYNGYHYAE
ILDSPPLLSVTDAQILANKCDGTIMILNTGVVDKRAVKKAKALLSASHTKILGVVLNNYKTPNHFNYYNGYHYAE
ILDSPP                                                            YYNGYHY  
© 1998-2019