BYKdb

Annotate results for A0A1A7LXJ0

A0A1A7LXJ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1A7LXJ0
DOMAINcd55/237TSSTPGEGKSTNASNIAVVYAQSGKKVLLVDGDMRKPTTHHTFGVRNVGGLSTVLIRQDT
VEEVVHETHIEGLSLITSGPIPPNPAELIASKTMDHFIETVKGKYDLVIFDAPPVLSVTD
AQILSNKCESTILVINSGKAEKENVIKAKEMLIASKANIIGAVLNNYAIDKNHYYYQYYG
AVE
SITEWalker A62/64GKS
SITEWalker A'82/89LLVDGDMR
SITEWalker B162/168VIFDAPP
SITEY Cluster228/233YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNKFKRKKSQPTTLARKLITDSNPKSIVSEQFKTVRTNINFSMPDKDLKTLVVTSSTPGEGKSTNASNIAVVYAQSGKK
                                                      TSSTPGEGKSTNASNIAVVYAQSGKK
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLVDGDMRKPTTHHTFGVRNVGGLSTVLIRQDTVEEVVHETHIEGLSLITSGPIPPNPAELIASKTMDHFIETVKGKYD
VLLVDGDMRKPTTHHTFGVRNVGGLSTVLIRQDTVEEVVHETHIEGLSLITSGPIPPNPAELIASKTMDHFIETVKGKYD
 LLVDGDMR                                                                       
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
LVIFDAPPVLSVTDAQILSNKCESTILVINSGKAEKENVIKAKEMLIASKANIIGAVLNNYAIDKNHYYYQYYGAVE
LVIFDAPPVLSVTDAQILSNKCESTILVINSGKAEKENVIKAKEMLIASKANIIGAVLNNYAIDKNHYYYQYYGAVE
 VIFDAPP                                                           YYYQYY    
© 1998-2019